KEGG   Lachancea thermotolerans: KLTH0H04180gHelp
Entry
KLTH0H04180g      CDS       T01117                                 

Definition
KLTH0H04180p
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lth  Lachancea thermotolerans
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:lth04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:381111..382172
Genome map
AA seq 353 aa AA seqDB search
MEYQNEGYGHSVVPDRPGMGERQRSLLPQRSAVSKGKYSLNDFQILRTLGTGSFGRVHLV
RSVHNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLVDHPFLIRMWGTFQDSRNLFMVM
DYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHDIIYRDLKPENILLDRNGHI
KITDFGFAKEVDTVTWTLCGTPDYIAPEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYD
ATPMKTYEKILQGKVAYPPFFHPDVVDLLSKLITADLTRRLGNLQSGPQDVKSHPWFSEV
IWEKLLAKDIETPYEPPITAGVGDSSLFDQYPEEQLDYGSQGDDPFMQYFIDF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggagtaccagaacgagggttacggccactctgtggtgccagacagacccggaatggga
gagcgtcaaagatcgctcctaccacagcgttcagcagtttccaaagggaagtactcgctg
aatgatttccagatactacgtacgctggggacaggctcattcggacgcgtgcacttagtg
cggtccgtgcacaacgggcgctactatgcaattaaggttctcaagaaagaacaagtcatc
agaatgaagcagattgagcacacgaacgatgagcggcgcatgcttaagctggtagaccac
ccattcttgattcgcatgtggggtacgttccaggattcgcgcaatcttttcatggtcatg
gactacatcgaaggtggtgaactcttctcgttgttgcgtaagtctcaacgttttccaaac
ccagtggccaagttctatgcggccgaagtaattctggccctggagtatctacatgcgcat
gatattatatatcgtgacctcaagccggagaacatcttgctggaccgtaacggccacatc
aagatcacggacttcggcttcgccaaggaggtcgacaccgtcacttggactctgtgtggt
acgccagactacattgcgcctgaggtcatcgctaccaagccttacaacaagtcagtcgat
tggtggtctctgggcatccttatctttgaaatgcttgcaggatacacgcctttctacgac
gcgacgcctatgaaaacttacgagaagattttgcaagggaaggtcgcgtatccacccttc
ttccacccggatgtggttgacctgctgtctaagctaatcaccgcagacctgaccaggaga
ttgggtaacttgcaaagcgggccccaggacgtcaagtcgcatccatggttcagtgaagta
atatgggaaaaactgctagcaaaggacattgaaacgccatacgagcccccaataaccgcg
ggagttggtgactcctcgctgtttgaccaatatcccgaagagcagctcgactacggaagt
cagggagatgacccctttatgcagtacttcatcgatttctga

DBGET integrated database retrieval system