KEGG   Lachancea thermotolerans: KLTH0H04180gHelp
Entry
KLTH0H04180g      CDS       T01117                                 

Definition
(RefSeq) KLTH0H04180p
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
lth  Lachancea thermotolerans
Pathway
lth04113  Meiosis - yeast
lth04138  Autophagy - yeast
lth04213  Longevity regulating pathway - multiple species
Module
lth_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:lth00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    KLTH0H04180g
  Cell growth and death
   04113 Meiosis - yeast
    KLTH0H04180g
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    KLTH0H04180g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     KLTH0H04180g
Protein kinases [BR:lth01001]
 Serine/threonine kinases: AGC group
  PKA family
   KLTH0H04180g
Messenger RNA biogenesis [BR:lth03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     KLTH0H04180g
Chromosome [BR:lth03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    KLTH0H04180g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 8294377
NCBI-ProteinID: XP_002556064
UniProt: C5E2E1
Position
H:381111..382172
Genome map
AA seq 353 aa AA seqDB search
MEYQNEGYGHSVVPDRPGMGERQRSLLPQRSAVSKGKYSLNDFQILRTLGTGSFGRVHLV
RSVHNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLVDHPFLIRMWGTFQDSRNLFMVM
DYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHDIIYRDLKPENILLDRNGHI
KITDFGFAKEVDTVTWTLCGTPDYIAPEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYD
ATPMKTYEKILQGKVAYPPFFHPDVVDLLSKLITADLTRRLGNLQSGPQDVKSHPWFSEV
IWEKLLAKDIETPYEPPITAGVGDSSLFDQYPEEQLDYGSQGDDPFMQYFIDF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggagtaccagaacgagggttacggccactctgtggtgccagacagacccggaatggga
gagcgtcaaagatcgctcctaccacagcgttcagcagtttccaaagggaagtactcgctg
aatgatttccagatactacgtacgctggggacaggctcattcggacgcgtgcacttagtg
cggtccgtgcacaacgggcgctactatgcaattaaggttctcaagaaagaacaagtcatc
agaatgaagcagattgagcacacgaacgatgagcggcgcatgcttaagctggtagaccac
ccattcttgattcgcatgtggggtacgttccaggattcgcgcaatcttttcatggtcatg
gactacatcgaaggtggtgaactcttctcgttgttgcgtaagtctcaacgttttccaaac
ccagtggccaagttctatgcggccgaagtaattctggccctggagtatctacatgcgcat
gatattatatatcgtgacctcaagccggagaacatcttgctggaccgtaacggccacatc
aagatcacggacttcggcttcgccaaggaggtcgacaccgtcacttggactctgtgtggt
acgccagactacattgcgcctgaggtcatcgctaccaagccttacaacaagtcagtcgat
tggtggtctctgggcatccttatctttgaaatgcttgcaggatacacgcctttctacgac
gcgacgcctatgaaaacttacgagaagattttgcaagggaaggtcgcgtatccacccttc
ttccacccggatgtggttgacctgctgtctaagctaatcaccgcagacctgaccaggaga
ttgggtaacttgcaaagcgggccccaggacgtcaagtcgcatccatggttcagtgaagta
atatgggaaaaactgctagcaaaggacattgaaacgccatacgagcccccaataaccgcg
ggagttggtgactcctcgctgtttgaccaatatcccgaagagcagctcgactacggaagt
cagggagatgacccctttatgcagtacttcatcgatttctga

DBGET integrated database retrieval system