KEGG   Lachancea thermotolerans: KLTH0H05588gHelp
Entry
KLTH0H05588g      CDS       T01117                                 

Definition
KLTH0H05588p
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lth  Lachancea thermotolerans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    KLTH0H05588g
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KLTH0H05588g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KLTH0H05588g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:complement(496922..497407)
Genome map
AA seq 161 aa AA seqDB search
MSKFYDLAPLDRTGKPFPFKQLEGKVVLIVNVASKCGFTPQYEELQELYKRYHDKGFEII
GFPCNQFGHQESGTDEEIGQFCKLNYGVTFPVMKKVHVNGDNADPVYEYLKNEKAGMLGF
KGIKWNFEKFLIDKHGNVYERYSSLTKPANLDAKVQKLLGA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaattctacgacctcgcacccctcgaccgcaccggcaagcccttccccttcaag
cagctggagggcaaggtggtgctcatcgtcaacgtcgcgtccaagtgcggcttcacgccg
cagtacgaggagctccaggagctctacaagcgctaccacgacaagggcttcgagatcatc
gggttcccctgcaaccagttcggccaccaggagagcggcacggacgaggagatcggccag
ttctgcaagctcaactacggcgtgacgttccccgtcatgaaaaaggtgcacgtcaacggc
gacaacgcggaccccgtgtacgagtacctcaagaacgagaaggccggcatgctgggcttc
aaaggcatcaagtggaacttcgagaagttcctcatcgacaagcacggcaacgtctacgag
cgctactcgtcgctgaccaagcccgccaacctggacgccaaggtccagaagctgctcggc
gcctga

DBGET integrated database retrieval system