KEGG   Lachancea thermotolerans: KLTH0H06336gHelp
Entry
KLTH0H06336g      CDS       T01117                                 

Definition
KLTH0H06336p
Orthology
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
lth  Lachancea thermotolerans
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
N-glycan biosynthesis, high-mannose type
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    KLTH0H06336g
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KLTH0H06336g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.84  glucan 1,3-alpha-glucosidase
     KLTH0H06336g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:555685..558462
Genome map
AA seq 925 aa AA seqDB search
MPRVCRKLQLALILVSIGQVLGFTDYLLKSCSQSGFCQRNRHYASEIERAQESPYSLDPA
SIQISNSNHTFQATIQKSIPDLLSFNETLIVELPVFVDVLDGGKVRFRIDERRETNNTYV
PEILNPKRYDEASLWAFQKDAKTQPVEVGIEKSLWSRKTSVTFIAPDSQVKIRVFLKQFR
IEFYFEENLVLVVNDRLLLNVEHLRTPEENTLQKLPEELTFNDFEDDFEYSKKDTLPFGP
ESVALDFTFVGVTDVFGIPEHADSLKLKDTRDGEPYRLFNADVFEYSLGARTPMYGAIPF
MIGSTPDFSAGIFWVNAADTWVDINYSESSTGTHWMSEAGTIDVIIFLAKTPQEVTSAYT
EITGRPQLPLSSSIGYHQCRWNYNDERDVLTVDSQMDKAGIPYDYIWLDLEYTDDKKFFT
WKPDAFPDPRRMLKKLHTLGRNLVTLIDPHLKVDYSASNTVEKSGASVRNSLGASYHGHC
WPGESIWIDTIGKNARKVWGKLMSNFLQDYNNLHIWNDMNEPSVFSGPETTAPKDLIHDG
GFEERSIHNLYGLTVHEATYNAMRENYGEKNRRPFILSRSFFAGSQRTAATWTGDNVANW
EYLKISIPMCLSNNVAGFPFIGADIAGFSGNPTTELLARWYQAGMWYPFFRGHAHIDAAR
REPYLFEEPLKSIVKDAILLRYSLMPTFYTAFYESSTKGSPIMNPVFFVHPELHECYGID
DQFYIGSSGLLVKPVTEQGATEVQVFFPAGQFYEFDSLKAFSVQEPSYLTIDAPIDKQPI
SIEGGHILFKKERYRRSSKLMEHDPYTLVIAPDVNGKAEGTLYIDDGETFAFQDGEYMKV
AVKLENDVLESTVTHMPTKFPNLSTHVERIIVGGGQYSSGPNRVTLKKDKTEWILETKIS
KNGHHAIIENPHLDLSKPWSLEVHR
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgtttgtcggaaacttcaattggcactgatactggtatcaattgggcaagtc
ctgggcttcactgactacctgctgaaatcatgttctcaatcgggcttctgtcaaagaaac
aggcattacgcttcagagatcgaaagggctcaggaaagcccatacagcctggaccctgct
agcattcaaattagtaactcgaatcacactttccaggccacgatccaaaaaagtattcca
gatcttcttagcttcaatgaaactctaatagttgagctgccggtcttcgttgatgttctt
gatggcggaaaagtccgcttcagaatagacgaaaggagagaaacaaacaatacttatgtt
cctgaaatcttaaaccccaagcgttacgacgaagcatccctctgggccttccagaaggac
gccaaaactcaacctgttgaagtgggcatcgagaaatctctctggtcccggaagacatct
gtcacattcatcgccccagattcgcaggtcaagataagagttttcctgaagcaatttaga
attgagttttacttcgaagaaaatctggttctggtggtgaatgacaggctgctcctaaac
gtcgaacacttaagaactccagaggaaaacactttgcaaaaattgccagaggagctgact
tttaacgactttgaagatgacttcgagtactctaaaaaagatactctgcctttcggtcca
gagtcagttgcgctggactttacatttgttggagttactgatgtttttggaattcctgag
cacgctgacagcctaaagctcaaagatacgcgggatggggaaccttatcgccttttcaat
gctgacgtcttcgagtacagcttaggtgccagaacacccatgtatggtgctatccctttt
atgattggaagtaccccagatttttctgctggtattttttgggtaaatgctgcggacacc
tgggtagatattaactacagtgagtcgagtaccggtacccactggatgtctgaagctgga
accatagatgtaatcatctttctcgcaaaaactccacaagaagtcacgtctgcatacaca
gaaatcacagggaggccgcaattgcctcttagctcgtccattggctaccaccaatgcaga
tggaactacaatgatgaaagggacgttctgactgttgactctcagatggacaaggctgga
attccttacgactacatttggttagatttagaatacacggatgacaaaaagttctttact
tggaagcctgatgctttccccgatccaaggaggatgctcaaaaagcttcatacgctgggc
agaaacctagttactttgattgatcctcacttgaaagttgactacagtgcaagtaacacg
gttgagaagagcggcgcttccgtgcgcaatagtctcggcgctagctaccatgggcactgc
tggccaggagagtcgatttggattgacacaattggcaaaaatgctcgtaaagtctggggc
aagctcatgtcaaacttcttgcaagactataacaacttacacatatggaacgacatgaat
gagccttctgtttttagtggaccggaaaccactgcaccaaaagatttgatacacgatggt
ggatttgaagaacgctcaatccacaacctttacgggctaacagttcatgaggccacttac
aacgccatgagagagaattatggagagaaaaatagaaggcctttcatcctgtccaggtct
ttcttcgcaggctctcaacgtacagccgccacctggacgggtgacaacgttgcaaactgg
gaatacttgaagatttcgatcccaatgtgcttatcaaataatgttgctggatttcctttc
attggcgccgatattgcaggattttctggaaaccccacaactgaactgcttgcacggtgg
tatcaagcaggcatgtggtaccctttctttagaggccatgcccatattgatgctgctcgc
agagaaccgtaccttttcgaagaaccactgaagtccattgtcaaagatgctattcttttg
agatactcgctgatgccaaccttctatacagcattttacgagtcaagcacaaagggttct
cctataatgaatcctgttttttttgtccaccccgaattgcacgaatgctacggaatagat
gaccagttttatattggcagtagtggtcttcttgtaaagccggtaacagagcaaggcgct
actgaagttcaagtttttttcccagcggggcagttttacgagtttgatagcctgaaagca
ttttctgtccaagagccatcatacttgacaatagatgcgcccattgacaagcaacccatt
tccatagaagggggtcacattcttttcaagaaagagagatatcggagatcgtcgaaattg
atggagcacgacccttacacgttagttattgctcccgatgtgaatggaaaggccgaagga
acgttgtatatagatgatggtgaaacgttcgctttccaggatggcgaatacatgaaggtt
gcagtgaagctcgagaacgacgtactagaatcaaccgtcactcacatgcctacaaaattt
ccaaatttatcaactcacgtcgagagaattatagtcgggggaggccaatactcaagtggc
ccaaatcgtgtcacattgaagaaggacaaaacggaatggatcctggaaacaaagatttca
aagaacggccatcacgcaatcatcgaaaacccacatcttgatctgtcgaagccttggtct
ctggaggttcaccgttaa

DBGET integrated database retrieval system