KEGG   Lachancea thermotolerans: KLTH0H06798gHelp
Entry
KLTH0H06798g      CDS       T01117                                 

Definition
KLTH0H06798p
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lth  Lachancea thermotolerans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    KLTH0H06798g
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    KLTH0H06798g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     KLTH0H06798g
Lipid biosynthesis proteins [BR:lth01004]
 Desaturase
  First
   KLTH0H06798g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:596966..598432
Genome map
AA seq 488 aa AA seqDB search
MADTKADKMEQVDLVKANILAAGANKESVRVVNGLGSLMGSKNMVNVDFDKDSNMDYLLR
KDQEEKDRYKNSKHISEQPWTIHNWHQHLNWLNMVLVVGIPLAGWYFALSGKVPLHMNVL
LFSIAYYVLGGVSITAGYHRLWSHRAYSARWPLRLFFAIFGAASVEGSIKWWGHSHRIHH
RYTDTVRDPYDARRGLWYSHMGWMLLQPNPKYRARADIADLTDDWIVRFQHRHYIPIMAF
SAFILPALLCKYLFNDFIGGLVYGGVLRVFAIQQATFCINSLAHYLGDQPFDDRRTPRDN
WITALVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKVFIFLSSLVGLSFNLKKFSQNAIQ
QGLVQQQQKKIDRQRSHLNWGTPLTQLPVWDKQQFMENIKTNPGLVIISGIVHDVSNYIT
EHPGGETLIQAALGKDATKAFNGGVYLHSNAAHNVLATMRVAVVKEGVDAAAKFAARRGE
SLEGKKLI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctgacacaaaagcagacaagatggagcaggtggacctggtcaaggccaacatcctg
gctgcgggcgcgaacaaggagtccgtgcgcgtggtcaacgggctggggtcgctgatgggc
tccaaaaacatggtgaacgtggatttcgacaaggactccaacatggactacctgctgcgc
aaggaccaggaggagaaggaccgctacaagaactctaagcacatctcggaacagccctgg
accatccacaactggcaccagcacctcaactggctgaacatggtgcttgtggtgggtatc
ccgctggccggctggtactttgctctgtcgggcaaggtgcccttgcatatgaacgtgttg
ctgttctccatcgcgtactacgttttgggcggtgtgtctatcactgcgggctaccaccgt
ctgtggtcgcaccgcgcctactccgcgcgctggcctctgcggttgttctttgccattttc
ggcgccgcctctgtcgagggttccatcaaatggtggggccactctcacagaatccaccac
cgttacacagacaccgtgagagacccttacgacgctcgtcgtggtctgtggtactcgcac
atgggatggatgctgctgcagcctaaccctaagtaccgtgccagagctgacattgctgac
ttgaccgacgactggattgtcagattccaacatagacactacattccaatcatggctttc
agcgctttcattctgccagctcttctctgcaagtacctgttcaacgacttcatcggcggt
ctcgtctacggtggtgtcctcagagtctttgccatccaacaggctaccttctgcatcaac
tccctggcccactacttgggtgaccagccattcgacgacagaagaactcctcgtgacaac
tggatcactgctttggtcactttcggtgagggttaccacaacttccaccacgagttcccc
accgactacagaaacgccatcaagtggtaccaatacgacccaaccaaggtcttcatcttc
ctcagctccctggtcggcttgtccttcaaccttaagaagttctctcagaacgctattcag
caaggtttggtccagcagcaacaaaagaagattgaccgtcaacgttcccacttgaactgg
ggtactcctttgactcagcttccagtttgggacaagcagcagttcatggaaaacatcaag
accaacccaggtttggttatcatctctggtatcgtgcacgatgtctccaactacattact
gagcacccaggtggtgagaccttgatccaagctgccttgggcaaggacgctactaaggct
ttcaacggtggtgtctacttgcactctaacgccgctcacaacgttctcgctaccatgaga
gttgctgttgttaaggagggtgttgacgctgctgccaagtttgctgctagaagaggtgag
tccctggaaggaaagaagctgatataa

DBGET integrated database retrieval system