KEGG   Lachancea thermotolerans: KLTH0H07370gHelp
Entry
KLTH0H07370g      CDS       T01117                                 

Definition
KLTH0H07370p
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLTH0H07370g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLTH0H07370g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:655985..658330
Genome map
AA seq 781 aa AA seqDB search
MSSAASKDGQEGSYSMYPPTSPAGPPASMQYGMGVYGNPNTFAQYGYGYPMPMDMYAGQG
APFLGYGINPNMMYYGGGSVPPPSGQKKKYYNKVENNGKTEAGNHHNNHHNGVHFYANGK
SGPTSNGTAIPAASPSGASKSVPITIKNQYKFELGNANSVSTTDLKLEYPFFANTDESEF
SKAQEKRRELTLRAFGEIYCGNFGENSQTQDPEVEASALESVETPVETPQASSSEELNAA
EKTEKSEQSTEQEKKETESRKSSVTSQAAPTKVIKSWSAVASSAVPKASPSSASDQKKDK
KYVPPTVKSLEPLGVVALRVCFDPQYVKYTADQYKGAGMALQSVIPRGIVNTGNICFMSS
ILQVLLFCEPFVNLMNLISVKTSAKMGSTGFLLLDACLELYRKFDKQAFEREKASRSSSG
VNISSALADAIKPDDFYKTLSKLPKFKDLRWGHQEDAEEFLTHLLDQLHEEFVNSIDSLS
DSEVISLINSINDEDTKTVFIRNLAKYKDAKFIKDSSNEIKSMLEKYDADVDDADDTSGN
GWQEVSSTSKKGKKTKTAAKRTVVVEPSPISVIFGGQFRSVLDVPQNKEPQSITLDPFQT
IQLDISDPDVNDLDSAFLKFSEMEHLPFKTSSGNNVEAKKQTFIDKLPEVFLIQLKRFSF
INNTDKSKIVNYNAYSGHVEKIRKKIHYGHELAIPDATISSVHSSFYKEAGTNYKLIGVV
YHHGVSPSGGHYTCDVYQETLNKWYRIDDTNVQEIEKDEVLKGGEEGNDSRTAYILIYQK
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcgcagcttccaaagacggtcaggaaggctcgtattcgatgtacccgccgaca
tcgcctgcgggccctccagccagcatgcaatatggaatgggcgtgtatggcaacccgaat
acgttcgcgcagtacgggtacggttacccaatgccgatggatatgtacgctgggcaaggt
gccccattccttggttacggcattaatccaaacatgatgtattacggtggcggaagcgtt
cctccccctagcggccagaaaaaaaagtactacaacaaagttgaaaacaatggtaaaact
gaagccggcaaccatcacaacaaccatcacaatggggtccacttctatgccaatggaaaa
tctggaccaacctcgaacggcacggcgatcccagctgcttcaccatcaggtgccagcaaa
agtgtccccatcactatcaaaaaccagtacaagtttgaattagggaatgccaactcggtc
agcaccacagatctcaagctcgaataccctttttttgcaaacaccgatgaaagtgagttc
agcaaagcacaggaaaagagaagagaattgacattgagggccttcggtgaaatatattgc
ggcaattttggcgagaatagccagactcaagacccggaggtggaagcatcagccctagaa
tccgtcgaaactcctgtggagactcctcaggctagttcctctgaagaattaaatgcagcc
gagaaaacggaaaagtcggagcaatcaaccgaacaagagaaaaaagagactgaaagcagg
aagtcttctgtcactagccaagctgctcccaccaaggtcattaaatcttggtcagcggtt
gcctctagcgcggtgccaaaggcatcgccttcatcagcctcggaccaaaagaaggacaaa
aaatacgttccaccaaccgtaaaaagtctggaaccgctgggggttgtggctttaagggtc
tgtttcgacccccaatatgtcaagtacacagccgaccaatacaagggtgctggaatggcg
ttgcagtcggtgattcctcgaggtattgtaaataccggaaacatatgtttcatgagctcc
atcttgcaagttctgctattttgtgaacctttcgttaacctcatgaacttaataagtgtg
aagacatctgccaagatgggaagcactgggtttttgcttttagatgcctgtctggagctc
tacaggaaatttgacaagcaggctttcgaaagagagaaagcttccaggagcagtagtggc
gttaatatttctagcgctttagcagatgctattaaacctgacgacttttacaaaactttg
tcaaagctacccaaattcaaggatcttagatggggtcatcaggaagacgctgaagagttt
ttgacccatcttctagaccagctgcatgaggaattcgtaaactcaatcgactcgctttca
gacagtgaggtgataagcctgatcaatagcatcaatgatgaggacaccaaaacagtcttc
atcagaaacctcgcaaaatacaaggatgcaaagttcataaaagattcatccaacgaaatc
aagagcatgctcgagaagtatgacgctgacgtcgacgacgctgacgacacttctggaaac
ggctggcaagaagtcagcagcaccagcaagaagggaaagaaaactaagacggctgccaag
aggacggttgtagttgaaccatctcccatttccgtcattttcgggggccaatttcggtct
gtgctggatgttccacagaacaaagaaccccagtctatcacgctggatccattccaaact
attcaactcgacatatctgatccggacgtgaacgacttggacagtgccttcctgaagttc
agcgagatggagcaccttcctttcaaaacttcgtcaggcaacaacgtggaagccaagaag
cagacgtttatcgacaagcttccggaagtattcttaatccaactcaagagattttcgttt
atcaataacacagacaagagcaagatcgtcaactataacgcatatagcggtcatgtggag
aagatccgcaagaagatacattatggccatgagttggcaatccccgatgcaacaatctcc
tccgtacactcttccttttacaaagaagcgggaactaactacaagctgataggggtcgtc
taccatcacggcgtgagccccagtggcggtcattacacttgtgacgtctaccaagaaacc
ctcaataagtggtacaggatagacgataccaacgtgcaggagatagagaaagatgaggtt
ttgaagggcggcgaggaaggaaacgactcgaggacagcctatatactaatataccaaaaa
ctgtaa

DBGET integrated database retrieval system