KEGG   Lachancea thermotolerans: KLTH0H07678gHelp
Entry
KLTH0H07678g      CDS       T01117                                 

Definition
KLTH0H07678p
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
lth  Lachancea thermotolerans
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:lth00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    KLTH0H07678g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     KLTH0H07678g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLTH0H07678g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:677217..679802
Genome map
AA seq 861 aa AA seqDB search
MPHSEETRMFCKSLTQLSRIADQFVKQDGENLDMETLLQECIDTLVNYQDECKKVRKLGP
GPDTRDPAVFEAYESAYVYYKIVSQIVLNKIPDLPQFVQAKDSAKSQKERGLLEVYNMLL
KTLLTDEKIGELRKFLKDHSRPEPRQHKKGAGDVSKTWANGQAISPSELQSLLGAQNALL
IDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEITRRSLITSPNEEVQLFQERDKFDY
IVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQRTIILTLQGGFENWCRNRGPCDKSE
SSEETNFASEYGVPPLIPKILPALRPIPPSAQDPLSVKGGMTLNTSLTHDKPLNTQPFPE
QQQPRLKRTSSFKDKFSSLTPSRSRAGSPSLQSPTILHTDSTTYPDAPQLAPSSVQLNAL
SQLQPIHSRAVTPQSKSLSPPRYNVNGSGQLTSDLMGHSPSPPKPVIFPVSSQSSVANYQ
NGSKPLTRRNTNFTVGLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSKLGS
KGVLAKYFSQLIHTMQQQAASASTKQNSGDKTAVQPLHFKVACGSINSLFRSSSQQDCQE
FCQFLLDGLHEDLNQCGGNPALKELSEEAEGIREKLCMRIASSIEWERYLTTDFSVIVDL
FQGQYASQLTCKVCGRTSTTYQPFSVLSVPVPSGSKCDIIDCFKEFTKVETLEKDEQWSC
PRCKCKQPSTKKITITRLPRNLVIHLKRFDNLLHKNNIFVSYPHTLDLTPFWANDFDGRL
PPGVAELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDKGDKAGWCYFDDTSWRKAKS
QGECITLSAYVLFYHRKYNVS
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgccccacagcgaggagaccaggatgttctgcaagtcgctcacacagctctcgcgcata
gcagaccagttcgtcaagcaggacggcgaaaacctcgacatggaaacgctccttcaggag
tgtatcgacaccctagtcaactaccaggacgagtgcaagaaggtgcgcaagctcggtccg
ggccccgacacgcgggacccggccgtcttcgaggcctacgagtccgcgtacgtctactac
aagatcgtctcgcagatcgtgctcaacaaaatcccagatctgccccagttcgtgcaggcc
aaggactccgcgaaaagccagaaggagcgcggtctcctcgaggtctacaacatgctgctc
aagaccctgctcacggacgagaagataggggagctgcgcaagttcctcaaggaccactcg
cggcccgagccccggcaacacaaaaagggtgccggcgacgtttcaaaaacctgggcgaac
ggtcaagccatatcgccctcggagctacagtctctgcttggagcccaaaacgccctcctg
atagaccttaggcctcgcataaaattcgtggagtcccacatcaaaaccgataaaataatg
tgcatagaacctatctctttcaaggacagctactcagacaccgagataacccggaggtcg
ctcataacctcgcccaacgaggaggtccagctgttccaagaaagagacaagttcgactac
atcgtaatatacaccgacgaacacgacagaactcagttctgcaagcagaaacaagcaagc
cttgtggacctcttggtgaaccgatcctttgaaaagccgctccagcgcacaatcatactg
acactgcaaggtggcttcgaaaactggtgccgcaaccgcggcccctgcgacaaatcggaa
tcctcagaagaaacgaacttcgcaagcgaatatggcgtcccgcctctcattcctaaaata
ctccccgcgctgcggcccatccctccctcggcacaggatccgctgagcgtgaaagggggt
atgaccctcaacacaagcctgacccacgacaaaccgctcaatacacagcctttccctgaa
caacagcagcccaggctcaagcgaacttcgagcttcaaagacaagttctcaagcttgacc
ccatcccgctctcgcgctggcagtccgtctttgcagtccccgactatattacatacggac
tctaccacgtacccggatgctccccagcttgccccctcctccgttcaacttaatgcgttg
tctcaactgcagcctatccactcaagagctgtgactccacagtcgaagagcttgtcgccg
ccccgctacaacgtaaatggcagtggccagttgactagcgatctgatgggccactcccct
tctccgccaaagcccgttatctttccagttagttcccaatcttcggtcgctaattatcag
aatggaagcaagccccttacaaggcgcaacaccaatttcaccgttggacttacaaacctg
ggcaattcgtgctatatgaactgcatcatacagtgtttacttggaacccatgagcttacg
cagatctttttggatgattcttacaaaaaccatgttaatcttaacagcaaattgggctct
aagggagtgcttgcaaagtatttttcgcagttgattcacacaatgcagcagcaggctgcg
tcagcgtcaaccaaacagaattcaggcgataagaccgctgttcagccacttcattttaaa
gtcgcatgcggctccatcaactctctttttagaagttcttctcagcaggactgtcaagaa
ttttgccaatttttactggacggattgcatgaagaccttaaccagtgcggcgggaacccc
gcgttgaaggagctttcagaagaagcagagggaatacgtgagaagctctgtatgaggata
gcaagctctattgagtgggagagatatctaactaccgacttcagtgtgattgttgattta
tttcaaggacagtacgcttcgcagcttacgtgtaaagtttgcggccggacctcgacgacc
tatcagcccttctcagtcctctcagttccagttcccagtggttccaagtgtgatattata
gattgcttcaaggaattcactaaagtggaaactctggaaaaggacgagcaatggtcttgt
ccccggtgcaagtgtaagcagccatccaccaagaaaattacaataacaaggttacctcgc
aaccttgtaattcatctaaaaaggtttgataacctgcttcacaaaaacaacatttttgta
tcgtaccctcacacgttagaccttacgccattttgggctaatgactttgatggaagatta
ccaccaggtgtggctgaactcccaaccagaggccaggtacctccatttaactacaacttg
tatgcggtggcttgtcactttggtacgctttatgggggacattatacttcgtacgttgac
aagggtgacaaagctgggtggtgttacttcgacgacacaagctggaggaaggccaaaagt
caaggtgaatgcatcaccctcagtgcgtatgtgttgttttatcaccgtaaatacaatgtt
tcttaa

DBGET integrated database retrieval system