KEGG   Lachancea thermotolerans: KLTH0H09086gHelp
Entry
KLTH0H09086g      CDS       T01117                                 

Definition
(RefSeq) KLTH0H09086p
  KO
K01440  nicotinamidase [EC:3.5.1.19]
Organism
lth  Lachancea thermotolerans
Pathway
lth00760  Nicotinate and nicotinamide metabolism
lth01100  Metabolic pathways
lth04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KLTH0H09086g
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    KLTH0H09086g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     KLTH0H09086g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-GeneID: 8294594
NCBI-ProteinID: XP_002556269
UniProt: C5E2Z6
Position
H:complement(779286..779927)
Genome map
AA seq 213 aa AA seqDB search
MGKALIVVDVQLDFLPPDGSLAVAAGDEIVDRIAELVKDPRWCVVVATQDWHPVDHISFA
KNHGLPEFSSYQYVSPVDRHETQQATLWPVHCVQGTPGAELAPALSESLQSLECDHHTVK
KGYISDREYYSAFNDIWNDHRTELDGLLRKHGVNDVFVVGLALDYCVKNTALSAAALGYR
TTILQDYTRAIASDSKSMCNLKQELVQNDITLK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagcattgattgttgtggatgttcagctcgacttcctgcctccagacggctcc
ctcgccgtggccgcgggtgatgagatagtcgaccgcattgcagagctcgtgaaggacccg
cgctggtgcgtggtcgtcgcgacgcaagactggcaccctgtggatcacatttcgttcgcc
aaaaaccacggcctaccggagttcagctcctaccagtacgtctcacccgtagaccgacac
gagacccagcaggccacactgtggcctgtgcactgtgtgcaggggacaccgggcgcagag
ctggctcccgcgttgagcgagagcctccagtcccttgaatgcgaccaccacaccgtcaag
aagggctacatctccgaccgtgagtactactcggccttcaacgatatttggaacgaccac
cgcactgagctggatggtctcttgcggaagcacggtgttaacgatgtatttgtcgtcgga
ctcgcgctcgactactgcgtcaaaaacacagctctctctgctgcggctcttggctacagg
accaccattctgcaagactacacccgtgcaatcgcttccgactccaagtccatgtgcaat
ttgaagcaggagttggttcagaacgacatcacgcttaagtga

DBGET integrated database retrieval system