KEGG   Lachancea thermotolerans: KLTH0H09262gHelp
Entry
KLTH0H09262g      CDS       T01117                                 

Definition
KLTH0H09262p
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
lth  Lachancea thermotolerans
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lth00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:797482..798405
Genome map
AA seq 307 aa AA seqDB search
MPYSYLESSTYGKDNVKFLKVKKDKTNPKVHEIMEATVCVLLKGDFEISYTEADNAPIVP
TDTVKNTILILAKKYDTFPIEKFAAKLALHFTSKYSHVSGLTVKITQDRWVKFDVDGKES
QHSFVHQGPEKKITFLDYDKKNGPSNYSLSSSIKDLTVLKSTNSMFYGYNVCDYTTLKPT
TDRILSTDIFATMDWCPKKLGCLESIASGSKDEIFTNAYNSARDITLDIFAKENSPSVQA
TMYNMATAILKIAPQVAYVSYELPNKHYFLFDLKWFQGLENDNELFYPSPHPNGLIKCKV
GRNGSKL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccatactcttacctagaaagctccacttacggaaaggacaatgtcaagttcttgaag
gtcaagaaagacaaaaccaacccaaaagtccacgagatcatggaagctactgtttgtgtt
ttattgaagggtgacttcgagatttcttacacggaagctgacaatgcccctattgttcct
actgacacggtcaagaacaccattttgatcttggccaaaaagtacgacactttcccaatc
gagaagtttgccgccaagcttgctttgcactttacctccaagtactcgcacgtctcgggc
cttactgtgaaaataactcaagaccgctgggttaagttcgatgtggatggcaaggagtca
caacactcattcgtccaccaaggtcctgagaagaagattacgttccttgactatgacaag
aagaacggaccctctaactactcgttgtcatcttctataaaggacctgactgttttgaag
tctaccaactcgatgttctacggctacaatgtctgcgattacactaccttgaagcctaca
acagaccgtatcctttcaactgatatcttcgccactatggactggtgccccaagaagctt
ggctgtctggaaagcattgcgtctggatctaaagacgaaatcttcacaaacgcttacaac
agcgcccgtgacataacgttggacattttcgccaaggaaaactccccctctgtgcaggcc
acaatgtataacatggcgaccgctatcttgaagattgctccacaagtcgcttacgtttcc
tatgaactgcccaacaagcattacttcctgtttgacctcaaatggttccaaggcttggag
aacgacaacgagctgttctacccatctcctcaccccaatggtttgatcaagtgtaaggtc
ggccgcaacggctctaagctgtga

DBGET integrated database retrieval system