KEGG   Lachancea thermotolerans: KLTH0H11418gHelp
Entry
KLTH0H11418g      CDS       T01117                                 

Definition
KLTH0H11418p
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
lth  Lachancea thermotolerans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KLTH0H11418g
Enzymes [BR:lth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     KLTH0H11418g
Glycosyltransferases [BR:lth01003]
 Polysaccharide
  Storage polysaccharide
   KLTH0H11418g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:complement(975327..977459)
Genome map
AA seq 710 aa AA seqDB search
MARDIQNQLLFEIATEVANRVGGIYSVLKSKAPITCARYRDNYTLIGLLNPETYQTEVEP
LDWRDSATFESSSAHTPEIRNALENMSNRGVQFVYGRWLIEGAPRVLLFQLDSVRAHLNE
WKSDLWDIAGIPSPEGDTWTDDAILLGYVVAWFLGELAHLDQRHAIIAHFHEWMAGVALP
LCRKRRIDVVTIFTTHATLLGRYLCAGNVDFYNNLDKFDVDSEAGKRGIYHRYCIERAAA
HTADVFTTVSQITAYESEYLLKRKPDGILPNGINVVKFQAVHEFQNLHALKKEKINDFVK
GHFHGHYDFNLDNTLYFFIAGRYEFRNKGADMFIEALARLNYRLKMANSRMTVVAFIIMP
AKNKSYTVDALKGQAVVTSLENTVKDVAGLIEKRLFEYAMRHPDGGTSGIPTELDQLLKP
SDKVLLKRRTLALRRPEGSLPPVVTHNMADDANDPVLNHIRRVQLFNNSNDRVKVIFHPE
FLNANNPILSLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGAYMED
LIEQDQAKDYGIYIVDRRFKNADESVEQLVDYMESFVKKTRRQRINQRNRTERLCDLLDW
KRMGLEYAKARQLALRRAYPDLFKAVVGEEVSDANMNSLAGGKKFKISRPLSVPGSPRDP
RAESIGSTILMTPGDLGTLQDANNADDYFHLSMGVEDEEEDEVNYLAAAD
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagacattcaaaaccaattgctgttcgaaatcgccacagaggtggccaacaga
gtcggcggcatctactcggtgctgaagtccaaggcgccaatcacgtgcgcgcgctaccga
gacaattacacgctaataggcctcttgaacccagaaacttaccaaactgaagtcgagcca
ctggactggcgcgactctgcaaccttcgagtcctccagcgcgcacacaccggagatccgg
aatgcgctcgaaaacatgagcaaccgcggcgtacaatttgtatacgggcggtggctcatt
gagggtgctccacgtgtgctcttgttccagcttgattccgtgcgcgcccacctcaacgaa
tggaaatctgatttgtgggacattgcaggcatcccttcgcccgaaggcgacacgtggaca
gacgatgcaatcttgctgggctacgtagtggcttggtttctgggcgagctcgctcatctc
gaccaaaggcatgccattattgcgcacttccacgaatggatggcaggtgtcgctctacct
ctatgccgcaagcggcggatagatgtagtcaccatttttactacgcacgccacgttgctc
ggtcgctacttgtgcgctggcaatgtggatttctacaacaacttggacaagttcgatgtg
gactccgaggccggtaagcgggggatttaccatcgttactgtatagaacgtgctgcagcc
cacactgcggacgtttttacaacagtatcccagatcactgcgtatgaatctgagtacctg
ctgaagcgtaagccagacgggattttaccaaacggcattaacgtagtgaaattccaagct
gtgcacgaatttcaaaacttgcacgcactgaagaaggagaaaatcaatgattttgtgaaa
ggacattttcatggccactatgacttcaatttggacaacaccctttatttctttatcgct
ggcagatatgagtttagaaataaaggtgccgatatgttcatagaggcactagcgcgcctg
aactacaggctgaaaatggcgaattctagaatgacggtggttgctttcatcattatgcct
gccaagaacaaatcctacactgtcgatgctttgaagggtcaggctgtggtcacatcactt
gaaaacaccgttaaggacgttgcaggtctcattgaaaagcgcctttttgaatatgcgatg
cgtcacccagatggcgggacctctgggataccaaccgagttggaccaactgcttaagccc
tccgataaagtactgctcaaaagacgcactttagcacttagacgcccggaaggctcgctg
cctcccgtagtcacgcacaacatggcggatgatgccaatgaccccgttcttaaccacata
agaagagtccagctgttcaacaactccaatgacagggtcaaggttatcttccatcccgag
tttttgaacgccaacaatcctattctatcattggattatgacgaatttgtgcgcggctgt
cacctgggtgttttcccatcctattatgagccttgggggtatacgccagccgaatgtact
gtcatgggcattccctctatcacaacaaatctctcaggatttggtgcgtacatggaggat
ctgatcgaacaagaccaggccaaggactacggcatctacattgttgatcgccgtttcaag
aacgcagacgaatcagtagagcagcttgttgattatatggagagttttgtcaaaaagact
cgccgacaaagaatcaaccaaaggaatagaaccgagcggctctgtgacctacttgactgg
aagcgcatgggcctggagtatgcgaaagcgagacaattggccttacgtcgagcatacccc
gacttgttcaaagctgttgttggcgaagaagttagcgacgccaacatgaactcattggct
ggaggcaagaagttcaaaatatcgcgtcctctaagtgttcctggatccccccgcgaccca
agagccgaaagcattggaagcactatcttgatgacacctggcgacttgggcaccttacaa
gatgctaacaacgccgatgactatttccacttgagcatgggtgtcgaggatgaggaagaa
gacgaagtgaactatctcgctgccgctgactag

  All links  
No link information was found.   
DBGET integrated database retrieval system