KEGG   Lachancea thermotolerans: KLTH0H13794gHelp
Entry
KLTH0H13794g      CDS       T01117                                 

Definition
KLTH0H13794p
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lth  Lachancea thermotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KLTH0H13794g
Enzymes [BR:lth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     KLTH0H13794g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KLTH0H13794g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:complement(1205666..1207783)
Genome map
AA seq 705 aa AA seqDB search
MGNVPENVRPAVELDPWLEPFAAVLSERRELADKWAGDIRGSLGAGREHTLAAFARDGYQ
QFGLHADARTKEIRYREWAPNAQRAFLVGDFNGWNTESHELTQRDQYGVFSTTIAPLASG
DFAIPHDSRIKVLLVLGDGTQLYRLPAWITRATQPDKETARQYGPSYEARFWNPPTQYEF
RHARPRFSRDLDSLRIYEAHIGISSPEPKVASYRDFTANVLPKIRELGYDAIQLMAIMEH
AYYASFGYQVTNFFAISSRYGTPEDLKELVDTAHGMGLLVLLDVVHSHASKNVEDGLNRF
DGSDHQYFHSLLSRRGEHPLWDSRLFNYGSFEVLRFLLSNLAFYVDIYHFDGFRFDGVTS
MLYNHHGVGAGGAFSGDYNEYLSKERSDVDHEALAYLMLANDLVRELLPESGVTIAEDVS
GYPTLCLPRASGGAGFDYRLAMALPDMWIKLLKEKSDDDWEMGNIVHTLTNRRHGEKVVA
YAESHDQALVGDKTLAFWLMDAAMYTDMTVLKPLTPVVDRGIALHKLIRLITHTLGGEAY
LNFEGNEFGHPEWLDFPNVNNHDSYHYARRQFNLVDDHLLRYRHLYNFDKAMQLCERQFK
WLNTPQAYISLKHEVDKVIAFERNGHLFIFNFHPTQSFADYRIGVERSGSYRIVLNSDRP
EFGGHNRIDEDNSKFFTTDLRWNNRSNYIQVYIPTRTALILALDN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgtgccagaaaacgtgagacccgcagttgagctcgacccctggctcgagccc
ttcgcagcagtactctcggagcgccgagagctcgcagacaagtgggctggtgatatccgt
gggagcctgggcgctggtcgtgagcacacgctagcagcattcgcgcgagacgggtaccag
caattcgggctccatgcggacgcgagaaccaaggagatccggtaccgcgagtgggcaccc
aacgcgcagcgcgcgttcctcgtgggcgacttcaacgggtggaacactgagtcgcacgag
ctgacgcagcgggaccaatacggggtgttttcgacaacaattgcgccgctggcttcgggc
gatttcgcaatcccacatgattctcgcatcaaagtcttgttagtactgggcgacggaacg
caattgtaccggctgcccgcgtggatcacgcgggcgacgcagccagacaaggagaccgcg
cggcagtacggccccagctacgaggcgcggttctggaacccacccacacagtacgagttc
cgccacgcacgcccacgtttcagccgtgatctggattcactgcgcatctacgaagcgcac
attggtatttcttcacctgagcccaaggtcgcgtcataccgcgactttacggccaacgtt
cttcccaagattcgcgaactgggctacgacgcgatccagctcatggccatcatggagcac
gcgtactatgcgtcgttcgggtaccaggtcacgaacttcttcgcgatcagctcgcggtac
ggcacgcccgaggacctgaaggaactcgtggacaccgcgcacggcatggggctgctggtc
ctgctcgacgttgtgcacagtcacgcgtctaagaacgttgaagacggcctcaacaggttc
gacgggtcggaccaccagtacttccactcgctcttgtcccgcaggggcgagcacccgctg
tgggactcgcgtctgttcaactacggcagtttcgaggtactgcgcttcctgctcagtaac
ctcgccttctacgtcgatatctatcactttgacgggttccgcttcgacggcgtcacttct
atgctttacaaccaccatggagtgggcgccggcggcgccttcagcggcgactacaacgag
tatctctccaaagagcggtctgatgtcgaccacgaggctctcgcatacctcatgctggct
aatgacttagtccgcgagctcttgccggaaagcggcgtcactatcgcagaggacgtctcc
gggtacccaacgctctgtctgcctcgcgcgagcggcggcgcgggcttcgactacagactt
gccatggcgctgcctgacatgtggattaaacttctaaaggagaagagtgacgacgactgg
gaaatgggcaacattgtccataccttaacgaaccgcaggcacggcgaaaaggttgtcgcc
tacgcagaatcccatgaccaggctctagtcggcgacaagaccctcgctttctggcttatg
gacgcagcgatgtacacagacatgactgtgctgaagcctctcactcccgttgtggaccgc
ggcatagcgctccacaagctcatccgcttgatcacccacaccctaggcggagaggcgtac
ctaaattttgagggcaacgaattcggccacccggagtggctagactttccgaacgttaac
aaccacgacagctatcactatgcgcgccgccaatttaacctggtcgacgaccatcttctc
cgctacaggcacctttacaactttgataaggccatgcagctttgcgagcgccaattcaag
tggctcaatacaccacaggcgtacatttcgctgaagcatgaggtggacaaagtcatcgct
ttcgagaggaacggacatcttttcatttttaacttccatcccactcagagtttcgccgac
tacagaattggggtcgaacggagcggcagctaccgcattgtgctcaatagcgaccgccca
gaattcggcggccacaacaggatcgacgaggacaattcgaagttctttaccacagatttg
cgctggaacaacagaagcaactacattcaagtgtatattcctaccaggacagctctaatt
ttggctctcgacaactga

DBGET integrated database retrieval system