KEGG   Lipotes vexillifer (Yangtze River dolphin): 103080876Help
Entry
103080876         CDS       T03090                                 

Gene name
LYZ
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:lve00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    103080876 (LYZ)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     103080876 (LYZ)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103080876 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 148 aa AA seqDB search
MKAVLILGLLLLSVAVQGKIFERCELARTLKRLGLDGYKGVSLANWMCLAKWESNYNTQA
TNYNPGSRSTDYGIFQINSRYWCNDGKTPGAHNACRMPCSALLKDDITEAVTCAKRVVRD
PQGVRAWVAWRSHCQNQDLRRYVQGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtccttattctggggcttctcctcctttctgtcgctgtccagggcaagatc
tttgagaggtgtgagcttgccagaactctgaaaagactcggattggatggctataaggga
gtcagcctggcaaactggatgtgtttggccaaatgggaaagcaattataacacacaagct
acaaactacaatcctggaagccgaagcactgattatgggatatttcaaatcaatagccgc
tactggtgtaatgatggcaaaaccccaggagcacataacgcctgtcgcatgccctgcagt
gcgttgctgaaagatgacatcactgaagctgtaacatgtgcaaagagggttgtccgtgat
ccacaaggtgttagagcatgggtggcatggagaagtcactgtcaaaaccaagatctcagg
agatatgttcagggttgcggagtgtaa

DBGET integrated database retrieval system