KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090527Help
Entry
103090527         CDS       T03090                                 

Gene name
AMY2A
Definition
amylase, alpha 2A (pancreatic)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:lve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103090527 (AMY2A)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    103090527 (AMY2A)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     103090527 (AMY2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 511 aa AA seqDB search
MKLFLLLSAIGFCWAQYAPNTESGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENAVINNPSRPWWERYQPVSYKLCTRSGNENEFKDMVTRCNNVGVHIYVDAIINHMCGN
GVAAGMSSTCGSYFNPGTEDFPAVPYSGWDFNDGKCKTGSGEIESYNDAFQVRDCRLVGL
LDLALEKDYVRSTVAEYLNRLIDIGVAGFRIDASKHMWPGDMKAILDKLHNLNTRWFPAG
SKPFIYQEVIDLGGEPIKSSEYFGNGRVTEFKYGAKLGTVLRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDPRLYKMGVGFMLAHPYGFTRVMSSYRWP
RHFENGQDVNDWIGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVVFRNVVDGQP
FTNWWDNGSNQVAFGRGNRGFIVFNNDDWALSSTLQTGLPAGTYCDVISGDKIGNDCTGI
KIYVSGDGNANFSISNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctttctattgctttcagccattggattctgctgggctcagtatgccccaaat
accgaatctggacggacatctattgtccatctgtttgagtggcgctgggttgatattgct
cttgaatgtgagcgatacttagctcccaaaggatttggaggggttcaggtttccccaccc
aatgaaaatgcggtaattaataacccttcaagaccttggtgggaaaggtaccaaccagtt
agctacaagttatgtacaagatcaggaaatgagaatgaattcaaagacatggtgactaga
tgtaacaacgttggtgtccatatttatgtggatgctataattaatcatatgtgtggaaat
ggtgtggctgcaggaatgagcagtacttgtgggagttacttcaaccctggaactgaggat
ttcccagcagtcccatactctggttgggattttaatgatggtaaatgtaaaactggaagt
ggagaaattgagagctataatgatgcttttcaggtccgagattgtcgtctggttggtctt
cttgatcttgcactggagaaagattatgtgcgctccacagttgctgaatatctgaaccgt
ctcattgacattggtgtagcagggttcagaattgatgcttctaagcacatgtggcctgga
gacatgaaggcaattttggataaactgcataatctaaacacaagatggttccctgcagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gagtactttggaaatggccgtgtgacagaatttaaatatggcgcaaaactaggcacagtt
ctacgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggctggggt
ttcatgccttctgacagagcacttgtctttgttgataaccatgacaatcagcgagggcat
ggagctgggggagcatctattcttacattctgggaccctagattgtacaaaatgggagtt
ggatttatgctcgctcatccctatggatttacacgagtaatgtcaagctaccgttggcca
agacattttgaaaatggacaagatgttaatgattggattgggccaccaaataataatgga
gtcattaaagaagttactattaatccagatactacttgtggcaatgactgggtctgtgaa
catcgatggcgtcaaataaggaacatggttgtgttccgtaatgtagttgatggccaacct
tttacaaactggtgggataatggtagcaaccaagtagcttttggaagaggaaacagagga
ttcattgtctttaacaatgatgactgggcattatcttcaactttgcaaactggtcttcct
gctggtacatattgtgatgtcatttctggagataaaattggtaacgattgtacagggatt
aaaatctatgtttccggcgatggcaatgctaatttttctattagtaactctgctgaagat
ccatttattgcgattcatgctgaatctaaattataa

DBGET integrated database retrieval system