KEGG   Listeria welshimeri SLCC5334: lwe0159Help
Entry
lwe0159           CDS       T00422                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lwe  Listeria welshimeri SLCC5334
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lwe00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159141..160016
Genome map
AA seq 291 aa AA seqDB search
MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLSLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFNVKMGVRIIIDKHIPVSAGLAGGSSDAAAALKGLNIIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKITALPNIPGCWIVLAKPSISVSTPTI
YKELQVENVEHPNTKKMIESIKIGDLDGIFASTGNVLESVTLEKNPQVKRIKDRMMAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSESENETIN
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcataacagcaccagctaaaattaatctttcacttgacgcgctgtacaaa
cgtgaagacggctatcatgaagtggaaatggtgatgacaacaatagaccttgctgacaga
ttaagcttagaacgcttagacgaggataagattgtgctagatgtaaaagcgcattttatc
ccagaagatcgtcgtaatttaatttaccaagcggctcttcttttgaaaaaacgttttaac
gtaaaaatgggtgtacgcattataattgataaacacattccagtttccgcgggacttgct
ggtggtagttcggatgcggccgcggcgctgaaaggtttaaacataatttgggaacttgga
ctttcgatagaagaattagcagaaataagctcagaaattggttctgatattgctttttgt
gtatatggaggaacggctcttgctaccggacgcggagaaaaaattacagctttacctaat
attccgggttgctggattgtattagctaaaccgagtattagtgtttctacacctactatt
tataaagaattacaagtagaaaatgttgaacatcctaatacaaagaaaatgatagaatcc
atcaaaattggcgacttagatgggatttttgcttcaaccggaaatgttttggaatctgtg
actttagaaaaaaatccacaagtgaaacgaattaaagatcggatgatggcatttggtgct
gaggcagcgttaatgagtggtagcggcccaacagtatttgcgctcatcaaacagtattca
agagcaaaacgtgtctataacggcttgcgaggcttttgtgaggaagtctatatggttaga
ccgtggagcgaaagtgaaaacgaaactattaattaa

DBGET integrated database retrieval system