KEGG   Listeria welshimeri: lwe0277Help
Entry
lwe0277           CDS       T00422                                 

Definition
AP endonuclease
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lwe  Listeria welshimeri
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    lwe0277
   00051 Fructose and mannose metabolism
    lwe0277
Enzymes [BR:lwe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     lwe0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
301825..302760
Genome map
AA seq 311 aa AA seqDB search
MKLATRINSFLSVYDNDLKNVFGEFKKLGLGYIDLNYPEHIEKFKAPEMKALIQENDLKL
NGVALRFRSEFINGELGNSDPKISANALKLCKDAADYCREAGGKVVTIWLGFDGFDYSFQ
INYKKVWEQLRNAFTEIADYAPDLKISIEYKPFQPRAYAFIDSMGLTGMMLNDINRDNVG
VTLDYCHMLMKHENPAFGADIFGSQGKLYGVHLNDGYGLNDDGLMIGSATPFKTLEFLYY
VKKHNYDGVIYFDTFPIIEHAAKECEQNIRMITALNAMIDNVGLAYIQTIIDKNDAVEAN
KLMLQFLTSSN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagctacaagaatcaattcgtttttatcagtttatgataatgatttaaaaaat
gtttttggagaatttaagaagttaggtttaggctacattgacttgaactatccagagcat
attgaaaaatttaaagcacctgaaatgaaagcgttaatccaagaaaatgacttgaaattg
aacggagtagctttaagatttagaagtgaatttattaatggagaattagggaattctgac
ccgaaaatttctgccaatgctttaaaactatgcaaagacgctgctgattattgtcgtgag
gctggcgggaaagtagtaaccatttggcttggatttgatggttttgactacagttttcaa
attaattacaaaaaagtttgggaacaattaagaaatgctttcacagaaattgcagattat
gcaccagatttaaaaatcagtattgaatataaaccatttcagcctagagcatatgctttt
attgatagtatgggactgacgggcatgatgttaaatgacattaatcgagacaatgtaggt
gtaacgttagattattgtcatatgttaatgaagcatgagaatccagctttcggagcagat
atttttggaagccaagggaaactatacggtgtgcatttgaatgatggatatggtttgaat
gatgatggattaatgataggttcagcaactccttttaaaacattagaatttctatactat
gtaaaaaaacataactatgatggcgttatttactttgatacattcccaatcattgagcac
gcggctaaagaatgtgaacaaaatattcgaatgattacagcattaaatgccatgattgat
aacgttggtttagcttatattcaaacaattattgataaaaatgatgctgttgaggctaat
aaattaatgcttcaatttttaactagctccaactaa

DBGET integrated database retrieval system