KEGG   Listeria welshimeri: lwe0297Help
Entry
lwe0297           CDS       T00422                                 

Definition
inorganic pyrophosphatase
Orthology
K01507  
inorganic pyrophosphatase [EC:3.6.1.1]
Organism
lwe  Listeria welshimeri
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    lwe0297
Enzymes [BR:lwe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     lwe0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321836..322165
Genome map
AA seq 109 aa AA seqDB search
MKKLKLKVTVDRPIGYTDKFGNVYPLNYGFVEGVIGGDGEEQDVYILSREISEPLETFEG
ELIAIITRKDDVEEKWIVAPPTEHFSVEEMKGKVHFIEQYFDSEIELIE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaaaattaaaagtaactgttgatcgaccaattggatacactgataaattc
ggtaatgtttatccgctgaattatggatttgtggaaggcgttattggtggtgatggggaa
gagcaagatgtttatattttatcacgagaaatatctgaaccacttgaaacctttgaaggc
gagctgattgcgataattactcggaaggatgatgtggaagagaagtggatagtagctcct
ccaacagagcattttagtgtggaagaaatgaagggaaaagtgcattttatcgagcaatac
ttcgattcggaaattgaattaattgagtga

DBGET integrated database retrieval system