KEGG   Listeria welshimeri SLCC5334: lwe0297Help
Entry
lwe0297           CDS       T00422                                 

Definition
inorganic pyrophosphatase
Orthology
K01507  
inorganic pyrophosphatase [EC:3.6.1.1]
Organism
lwe  Listeria welshimeri SLCC5334
Pathway
Oxidative phosphorylation
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:lwe00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321836..322165
Genome map
AA seq 109 aa AA seqDB search
MKKLKLKVTVDRPIGYTDKFGNVYPLNYGFVEGVIGGDGEEQDVYILSREISEPLETFEG
ELIAIITRKDDVEEKWIVAPPTEHFSVEEMKGKVHFIEQYFDSEIELIE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaaaattaaaagtaactgttgatcgaccaattggatacactgataaattc
ggtaatgtttatccgctgaattatggatttgtggaaggcgttattggtggtgatggggaa
gagcaagatgtttatattttatcacgagaaatatctgaaccacttgaaacctttgaaggc
gagctgattgcgataattactcggaaggatgatgtggaagagaagtggatagtagctcct
ccaacagagcattttagtgtggaagaaatgaagggaaaagtgcattttatcgagcaatac
ttcgattcggaaattgaattaattgagtga

DBGET integrated database retrieval system