KEGG   Listeria welshimeri: lwe0302Help
Entry
lwe0302           CDS       T00422                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lwe  Listeria welshimeri
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lwe0302
   01230 Biosynthesis of amino acids
    lwe0302
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lwe0302
   00051 Fructose and mannose metabolism
    lwe0302
   00562 Inositol phosphate metabolism
    lwe0302
Enzymes [BR:lwe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lwe0302
Exosome [BR:lwe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lwe0302
  Exosomal proteins of bladder cancer cells
   lwe0302
  Exosomal proteins of melanoma cells
   lwe0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(326246..327010)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAGTSEWLEATIPLLENFTDVDTFIFPSMGTLETTASLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLKANYVEIGHAERKNLFHEKSSEIAKKIKLALDE
KITPVVCVGESVRANNTDELKMALNKQIEALFEAINVAQWENVVLAYEPEWAIGKSSSAD
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVHQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaattacattaatacgcgggctggaaca
tcggaatggttagaagcaactattcctctccttgaaaattttactgatgtggatacgttt
atctttccatctatgggaacactcgaaacgactgccagccttttagcgggtacatcattt
ggttttggaccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttca
gtggaatcaatcattgacctgaaagcaaactatgtcgaaattggccacgcggaacgcaag
aacctttttcatgagaaaagcagtgaaatagccaaaaaaattaaactcgcactggacgaa
aaaatcactccagttgtgtgtgtaggtgaaagtgttcgcgcgaataacacagatgaatta
aaaatggcgctaaacaaacaaatagaagcactgtttgaagcaattaatgtagcacagtgg
gaaaatgttgttctggcttatgaaccagaatgggcaattggcaagtcctcttccgctgac
accaattatatcgaaagcgctcatcaagctttgcgcgaaattatccgcgaacttggcggc
gatgaaacgcttgtaaggattatttatggcggttcggtcagcaaagaaaatgccgcagaa
attgttcatcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtctctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system