KEGG   Listeria welshimeri: lwe0704Help
Entry
lwe0704           CDS       T00422                                 

Definition
ribulose-5-phosphate 3-epimerase
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
lwe  Listeria welshimeri
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lwe0704
   01230 Biosynthesis of amino acids
    lwe0704
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    lwe0704
   00040 Pentose and glucuronate interconversions
    lwe0704
Enzymes [BR:lwe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     lwe0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
731336..732007
Genome map
AA seq 223 aa AA seqDB search
MTKKLLCPSMMCADFSNLQKEIEELDRAGSDIFHIDIMDGEFVPSFGMGLQDFKEIRNKT
QKLVDVHLMIMNPGNYVELFADSGADIIYIHPEADKHPARTLDKIRKKGKKTGVAINPGT
AISTIKELLPLVDYLMVMTVNPGFSGQTYLDYVDDKIIELVQLKKKYPFEIMVDGAISPE
KIAKLSKIGVRGFVLGTSALFGKKEDYAKIIKHLKQEDMEEVR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaattgctttgcccctcaatgatgtgtgctgatttttctaatctccaaaag
gaaattgaagaactagaccgagctggaagtgacatctttcatatagatataatggatggt
gaatttgtaccgagctttggcatgggattgcaagattttaaagaaattcgaaataaaacg
cagaaactagtggatgttcatttaatgataatgaatccaggtaactatgtggagttattt
gctgattcgggtgccgatattatttatattcatccagaagcagataaacatccagcaaga
actttagacaaaatacgaaaaaaagggaagaaaacaggtgtggctattaatcctggaact
gctatttctacgataaaagaacttttgccattagtagattatttgatggtgatgactgtt
aatccgggcttttcgggtcaaacgtatcttgattatgtggatgacaaaataatagaactg
gttcaattaaaaaagaaatatccctttgaaattatggtcgatggggctatatctccagaa
aaaattgctaaactttctaaaattggcgtccgaggatttgtacttggaacctcagcgcta
tttggtaaaaaagaggactatgctaaaattattaaacatttaaaacaagaagatatggag
gaagtacgatga

DBGET integrated database retrieval system