KEGG   Listeria welshimeri SLCC5334: lwe0958Help
Entry
lwe0958           CDS       T00422                                 

Gene name
rpiA
Definition
ribose-5-phosphate isomerase A
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
lwe  Listeria welshimeri SLCC5334
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:lwe01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lwe01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lwe00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
982047..982718
Genome map
AA seq 223 aa AA seqDB search
MNQKKIAGEKACGWVKDGMVVGLGTGSTVYYTIEKLGEMVRDGLNITGIATSEETAIQAK
KLGIPLKSLNDVKQIDVTIDGADEVNKDFQGIKGGGGALLREKMVAAASLMNIWVVEEKK
LVEELGEFSLPIEVIPFGWKQIKWSLEKEAIETELRKNDSGKVYQTNNGNYILDIKNQIL
TNPVEWQEKLAGIPGIVEHGLFLDYVDIVICGKANGEAIVIKK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagaagaaaattgcaggagaaaaagcatgtggatgggtgaaagatggaatggtt
gtcggacttggaacagggagtactgtttactatacaatcgaaaaattaggagaaatggta
cgtgacggtctcaatattactggaattgctacatctgaagaaactgcaatacaagctaaa
aaactgggcatcccattaaaatctttaaatgatgtaaagcaaatagatgtcacaattgat
ggagcagatgaagtgaacaaagattttcaagggataaaaggtggaggaggagcgctttta
cgcgaaaaaatggtagcagcagctagcttgatgaatatttgggtagtggaagaaaagaaa
ttagtggaagaacttggcgaattttcacttccaatagaagtaattccatttggctggaaa
caaattaagtggagtcttgaaaaagaagcaattgaaacagaattacgaaaaaatgattca
ggaaaagtgtatcagacaaataatggaaattatattttggacattaaaaatcaaattttg
acgaatccagtagaatggcaagaaaaactagcggggattcctggaattgtcgagcatgga
ttgtttttagattatgtggatatagttatttgtggaaaagcaaatggagaagcaatagta
ataaaaaaatag

DBGET integrated database retrieval system