KEGG   Listeria welshimeri: lwe0958Help
Entry
lwe0958           CDS       T00422                                 

Gene name
rpiA
Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
lwe  Listeria welshimeri
Pathway
lwe00030  Pentose phosphate pathway
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01120  Microbial metabolism in diverse environments
lwe01130  Biosynthesis of antibiotics
lwe01200  Carbon metabolism
lwe01230  Biosynthesis of amino acids
Module
lwe_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lwe_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    lwe0958 (rpiA)
Enzymes [BR:lwe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     lwe0958 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC tRNA_U5-meth_tr
Motif
Other DBs
NCBI-ProteinID: CAK20376
UniProt: A0AH94
Position
982047..982718
Genome map
AA seq 223 aa AA seqDB search
MNQKKIAGEKACGWVKDGMVVGLGTGSTVYYTIEKLGEMVRDGLNITGIATSEETAIQAK
KLGIPLKSLNDVKQIDVTIDGADEVNKDFQGIKGGGGALLREKMVAAASLMNIWVVEEKK
LVEELGEFSLPIEVIPFGWKQIKWSLEKEAIETELRKNDSGKVYQTNNGNYILDIKNQIL
TNPVEWQEKLAGIPGIVEHGLFLDYVDIVICGKANGEAIVIKK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagaagaaaattgcaggagaaaaagcatgtggatgggtgaaagatggaatggtt
gtcggacttggaacagggagtactgtttactatacaatcgaaaaattaggagaaatggta
cgtgacggtctcaatattactggaattgctacatctgaagaaactgcaatacaagctaaa
aaactgggcatcccattaaaatctttaaatgatgtaaagcaaatagatgtcacaattgat
ggagcagatgaagtgaacaaagattttcaagggataaaaggtggaggaggagcgctttta
cgcgaaaaaatggtagcagcagctagcttgatgaatatttgggtagtggaagaaaagaaa
ttagtggaagaacttggcgaattttcacttccaatagaagtaattccatttggctggaaa
caaattaagtggagtcttgaaaaagaagcaattgaaacagaattacgaaaaaatgattca
ggaaaagtgtatcagacaaataatggaaattatattttggacattaaaaatcaaattttg
acgaatccagtagaatggcaagaaaaactagcggggattcctggaattgtcgagcatgga
ttgtttttagattatgtggatatagttatttgtggaaaagcaaatggagaagcaatagta
ataaaaaaatag

DBGET integrated database retrieval system