KEGG   Listeria welshimeri: lwe0958Help
Entry
lwe0958           CDS       T00422                                 

Gene name
rpiA
Definition
ribose-5-phosphate isomerase A
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
lwe  Listeria welshimeri
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lwe0958 (rpiA)
   01230 Biosynthesis of amino acids
    lwe0958 (rpiA)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    lwe0958 (rpiA)
Enzymes [BR:lwe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     lwe0958 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
982047..982718
Genome map
AA seq 223 aa AA seqDB search
MNQKKIAGEKACGWVKDGMVVGLGTGSTVYYTIEKLGEMVRDGLNITGIATSEETAIQAK
KLGIPLKSLNDVKQIDVTIDGADEVNKDFQGIKGGGGALLREKMVAAASLMNIWVVEEKK
LVEELGEFSLPIEVIPFGWKQIKWSLEKEAIETELRKNDSGKVYQTNNGNYILDIKNQIL
TNPVEWQEKLAGIPGIVEHGLFLDYVDIVICGKANGEAIVIKK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagaagaaaattgcaggagaaaaagcatgtggatgggtgaaagatggaatggtt
gtcggacttggaacagggagtactgtttactatacaatcgaaaaattaggagaaatggta
cgtgacggtctcaatattactggaattgctacatctgaagaaactgcaatacaagctaaa
aaactgggcatcccattaaaatctttaaatgatgtaaagcaaatagatgtcacaattgat
ggagcagatgaagtgaacaaagattttcaagggataaaaggtggaggaggagcgctttta
cgcgaaaaaatggtagcagcagctagcttgatgaatatttgggtagtggaagaaaagaaa
ttagtggaagaacttggcgaattttcacttccaatagaagtaattccatttggctggaaa
caaattaagtggagtcttgaaaaagaagcaattgaaacagaattacgaaaaaatgattca
ggaaaagtgtatcagacaaataatggaaattatattttggacattaaaaatcaaattttg
acgaatccagtagaatggcaagaaaaactagcggggattcctggaattgtcgagcatgga
ttgtttttagattatgtggatatagttatttgtggaaaagcaaatggagaagcaatagta
ataaaaaaatag

DBGET integrated database retrieval system