KEGG   Listeria welshimeri: lwe1059Help
Entry
lwe1059           CDS       T00422                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lwe  Listeria welshimeri
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    lwe1059 (galU)
   00052 Galactose metabolism
    lwe1059 (galU)
   00500 Starch and sucrose metabolism
    lwe1059 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    lwe1059 (galU)
Enzymes [BR:lwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     lwe1059 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1079099..1079986)
Genome map
AA seq 295 aa AA seqDB search
MRVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVESGIEDILIVTGKGK
RAIEDHFDSVPELELNLREKNKLELLHLIEETTNINLHFIRQSKPKGLGDAILQARGFVG
NEPFIVMLGDDIVQAKTPCAKQLIDQYEKTHSSIIGVQTVPHEETYRYGIIDPIDEYSKN
LYNVNGFVEKPDPSAAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEIQ
RVFAYDFEGERFDVGDKFGFIKTTMQFALKHPEIKDDVAKLVDQLYAEIHSKDKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaaaaagcagtcattccagcagcaggattagggacgagatttctgcctgcc
acaaaagcaatgcctaaagaaatacttccaatagtagacaagccaaccattcaatacata
gtagaagaagcggtagaatctggaattgaagatattctaatcgttactggtaaaggaaaa
agagctattgaagaccactttgactccgttcctgaacttgagcttaacctacgcgaaaaa
aacaaactagaattacttcatttaattgaagaaacaacaaatattaaccttcacttcatt
cgtcaatctaaacctaaaggacttggtgatgcgattcttcaagctagagggtttgtgggt
aatgagccatttattgttatgttaggtgatgacattgttcaagcaaaaacaccatgtgca
aaacagttaatagatcaatacgaaaaaacacatagttctatcattggagttcaaacggtt
cctcatgaagaaacttatcgttatggcattatcgatccaattgatgaatatagtaaaaac
ctatacaatgtaaatggttttgtagaaaagcctgatccaagtgcagcgccttctgacctt
gctattcttggtagatatctactaacaccgcagatttttgacttcttagaaacacaaaaa
cctggtgctggtggcgaaatccaattaactgacgctatcaacagtttaaatgaaattcaa
cgagtttttgcttatgattttgaaggagaacgctttgatgttggtgataaattcggtttt
atcaagacgaccatgcaatttgctttaaagcatccagaaattaaggatgatgttgcaaaa
ttggtagatcagctttatgcagaaattcactcgaaggataaaaaataa

DBGET integrated database retrieval system