KEGG   Listeria welshimeri: lwe1134Help
Entry
lwe1134           CDS       T00422                                 

Gene name
eutC
Definition
ethanolamine ammonia-lyase small subunit
Orthology
K03736  
ethanolamine ammonia-lyase small subunit [EC:4.3.1.7]
Organism
lwe  Listeria welshimeri
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    lwe1134 (eutC)
Enzymes [BR:lwe01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.7  ethanolamine ammonia-lyase
     lwe1134 (eutC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1148073..1148954
Genome map
AA seq 293 aa AA seqDB search
MNEQELKQMIEGILTEMSGGKTTETVEATPAKAITETVVTEGSIPDITEVDIKKQLLVPE
PADREGYLKMKQMTPARLGLWRAGPRYKTETILRFRADHAVAQDSVFSYVSEDLVKEMNF
TPVNTKCQDKDEYLTRPDLGREFDDEMVEVIRANTTKNAKLQIVVGDGLSSAAIEANIKD
ILPSIKQGLKMYNLDFDNIIFVKHCRVPSMDQIGEITGADVVCLLVGERPGLVTAESMSA
YIAYKPTIGMPEARRTVISNIHSGGTPPVEAGAYIAELIHNMLEKKCSGIDLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaagaattaaaacaaatgattgaaggcattttaacagaaatgtctggtggt
aaaacaactgaaactgtcgaagccacaccagcaaaagcaataactgaaactgttgtaaca
gaaggaagtatccctgatattaccgaagttgacattaaaaaacaattactagtaccagaa
cctgctgaccgcgaaggttatttgaaaatgaaacaaatgactccggcaagacttggttta
tggcgcgctggtccacgttacaaaacagaaacaattcttcgtttccgtgcggatcatgca
gtagcacaagattccgtattctcttacgtttctgaggatttagtaaaagaaatgaacttc
accccagtcaacactaaatgccaagataaagatgaatacttaactcgccctgacttaggt
cgtgaatttgacgatgaaatggtagaagtaattcgcgctaacacaacgaaaaatgcgaaa
ctgcaaattgttgtaggcgacggtcttagttctgcagcaattgaagctaacatcaaagac
attttaccatccattaaacaaggtttgaaaatgtataacttagattttgataacattatt
tttgttaaacattgtcgtgtaccttccatggatcaaatcggtgaaatcactggggcggat
gtagtttgcttacttgtaggtgaacgcccaggacttgtaacagctgaatccatgagtgct
tatattgcttacaaaccaactattggtatgccagaagctcgtcgtacagttatttcgaat
attcatagcggcggaactccacctgtggaagctggcgcgtacattgcagaattaattcac
aatatgcttgagaaaaaatgttctggtattgatctaaaataa

DBGET integrated database retrieval system