KEGG   Listeria welshimeri SLCC5334: lwe1134Help
Entry
lwe1134           CDS       T00422                                 

Gene name
eutC
Definition
ethanolamine ammonia-lyase small subunit
Orthology
K03736  
ethanolamine ammonia-lyase small subunit [EC:4.3.1.7]
Organism
lwe  Listeria welshimeri SLCC5334
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:lwe00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1148073..1148954
Genome map
AA seq 293 aa AA seqDB search
MNEQELKQMIEGILTEMSGGKTTETVEATPAKAITETVVTEGSIPDITEVDIKKQLLVPE
PADREGYLKMKQMTPARLGLWRAGPRYKTETILRFRADHAVAQDSVFSYVSEDLVKEMNF
TPVNTKCQDKDEYLTRPDLGREFDDEMVEVIRANTTKNAKLQIVVGDGLSSAAIEANIKD
ILPSIKQGLKMYNLDFDNIIFVKHCRVPSMDQIGEITGADVVCLLVGERPGLVTAESMSA
YIAYKPTIGMPEARRTVISNIHSGGTPPVEAGAYIAELIHNMLEKKCSGIDLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaagaattaaaacaaatgattgaaggcattttaacagaaatgtctggtggt
aaaacaactgaaactgtcgaagccacaccagcaaaagcaataactgaaactgttgtaaca
gaaggaagtatccctgatattaccgaagttgacattaaaaaacaattactagtaccagaa
cctgctgaccgcgaaggttatttgaaaatgaaacaaatgactccggcaagacttggttta
tggcgcgctggtccacgttacaaaacagaaacaattcttcgtttccgtgcggatcatgca
gtagcacaagattccgtattctcttacgtttctgaggatttagtaaaagaaatgaacttc
accccagtcaacactaaatgccaagataaagatgaatacttaactcgccctgacttaggt
cgtgaatttgacgatgaaatggtagaagtaattcgcgctaacacaacgaaaaatgcgaaa
ctgcaaattgttgtaggcgacggtcttagttctgcagcaattgaagctaacatcaaagac
attttaccatccattaaacaaggtttgaaaatgtataacttagattttgataacattatt
tttgttaaacattgtcgtgtaccttccatggatcaaatcggtgaaatcactggggcggat
gtagtttgcttacttgtaggtgaacgcccaggacttgtaacagctgaatccatgagtgct
tatattgcttacaaaccaactattggtatgccagaagctcgtcgtacagttatttcgaat
attcatagcggcggaactccacctgtggaagctggcgcgtacattgcagaattaattcac
aatatgcttgagaaaaaatgttctggtattgatctaaaataa

DBGET integrated database retrieval system