KEGG   Listeria welshimeri: lwe1158Help
Entry
lwe1158           CDS       T00422                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase/methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lwe  Listeria welshimeri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    lwe1158 (hemD)
Enzymes [BR:lwe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     lwe1158 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     lwe1158 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1166659..1168140
Genome map
AA seq 493 aa AA seqDB search
MGKVMLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEKAMLQERKASCKLIYVGKEPLH
HPIPQEEIEQILVREAATNELVVRLKAGDPYVFGRGGEEGETLYKAGIPFEVIPGITSAI
GGLAYAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICAN
LLANGQKPETGVAIVQWASRGKQLTVTGNLQTIEQKVAESGISSPALIVVGEVVSLRPQL
NFFEEMPLFHTKVLLPRARAGKSKLAEQIRDLGGEVTMYPNIQVLDVTPTKTKQELCETR
EIIFTSKEAVERFFNYLATLHLDIRTLKNTHLTAIGKQTKEALSEKGIVPDSFIQRRSAE
LILEHLARFQKNSSNLIIGSVVDTAEVGAILSNVKAIEMMPLYDLRPVTERPFDLESFEQ
ICFSSSRSVQNLLDVLTTEEKAILKTKTILSIGRFTSATLQSFGINDFEEADSATPESLI
ELIQKTKLEGVPQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtcatgttaattggcgcaggtcctggagatgcacaactgctcacagtaaaa
ggattagccgcacttcaaaaagcggatgttattgtgtatgatcgtctcgtggaaaaagca
atgctccaagaacgaaaagcgagctgcaaacttatttatgtgggaaaagaaccgttacat
catccaattcctcaagaagaaatcgaacaaatccttgttagggaagctgcaacaaatgag
cttgtcgttcgcttgaaagcaggtgatccatatgtatttggacgtggtggagaagaagga
gaaacactttataaagcgggaattccttttgaagttatccctggaatcacctcagctatt
ggtggacttgcttatgcgggaattccggtcacacaccgtgattttgcttcaagtttccac
gtgattaccggtcatttgaaaaaaggacgggatccactagactgggaagctcttgctagg
ttagaaggtacactcgtttttctgatgggaatgacaaacttgcctaatatttgcgcgaat
ttactagcaaatggacaaaaaccagaaactggggttgcgattgtgcaatgggcatcccga
ggcaaacaattaactgttactggaaatttacaaactatcgagcaaaaagtagcagagtcc
ggtatttcatcacctgcgcttatcgttgttggtgaagtagtgagcttacggccacagctt
aacttttttgaagaaatgccgcttttccataccaaagtcttacttccaagagcacgagct
ggtaaaagtaagctcgcagaacaaattcgtgatttaggcggagaagtaacaatgtatcca
aatattcaagtattggatgtgacaccaacaaaaacaaaacaagaattatgcgaaactcgt
gaaattatttttacatcaaaagaggcagtagagcgattttttaattatctagcgacgctt
catttagatattcgtactttgaaaaatacacacctcacagctattggcaaacaaacgaaa
gaagcactcagcgaaaaaggaattgttccagatagttttatacaaagaagaagtgctgag
ttgattttagagcatttagcaagatttcaaaaaaattcgagcaatttgattattgggagt
gtagttgacacagcagaagttggcgctattttgtctaatgtaaaggcaatagaaatgatg
cctttatacgatttgcgaccagtgacagaacgtccatttgatcttgaaagctttgaacaa
atttgtttttcaagttctcgttcggtccaaaatctactcgatgtattaacaaccgaagaa
aaagcaattttaaaaacgaaaaccatcctttccattggacgattcacgagcgcaaccttg
cagtcatttggtattaatgattttgaagaagctgatagtgcaacaccagagagcttaatt
gaattaatccaaaaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system