KEGG   Listeria welshimeri: lwe1354Help
Entry
lwe1354           CDS       T00422                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lwe  Listeria welshimeri
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lwe1354 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lwe1354 (glcK)
   00052 Galactose metabolism
    lwe1354 (glcK)
   00500 Starch and sucrose metabolism
    lwe1354 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    lwe1354 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lwe1354 (glcK)
   00524 Butirosin and neomycin biosynthesis
    lwe1354 (glcK)
Enzymes [BR:lwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     lwe1354 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1345289..1346257
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKDGDIQEKWTIDTNIEDKGSHIVKDIGDSINQKLTDLQL
DNDNFYGIGMGTPGTVNYETGTVKGAYNLGWAEEQNISEDLEKITGLTIRLDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGVRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDFAKEFNGESKLKKAIENQENITSKLIFELGAEGDELATET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKNYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPTED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcggtacaaccgcaaaattagctatttta
acaaaagatggagatattcaagagaaatggacgattgatactaatatcgaagacaaaggt
tctcatattgtaaaagatattggtgactccattaatcaaaaactaactgatttacagctt
gataatgacaatttttacggaattggaatgggaacacccggaactgtcaattatgaaact
ggaactgtaaaaggtgcttataatctaggttgggcagaagagcagaatattagcgaagac
ttagaaaaaattaccggcttaacaatcagattggacaatgatgctaacgtagctgctctt
ggtgaacgttggaagggtgcaggagaaggcggagcaaacgttgtatttgttacacttgga
actggcgttggcggcggaatttttgcagaaggaaagattttacatggtgtacgtggtgca
gctggtgaaattggccatgtaacagtagttccagaaaatggttatgactgtacatgtggt
aaaaaaggttgtttagaaactgtagcatctgcaactggtattgttcgtgttgcaaaagat
ttcgcaaaagagtttaatggtgaatccaaacttaaaaaagcaattgaaaatcaagaaaat
attacatctaaattaatttttgagttaggtgctgaaggcgatgaattagcaacagaaaca
attgacaaaatttcgttttacttagctcttgcgcttagtcatataggaaacatgttaaat
ccagaaaaaattattattggtggcggcgtttcagcagcaggagatcaactattgacgcca
gttaaaaattattttgaaacgatggtatttccagcagttaaagagtcgaccaagttatct
attgcaacaaaaggaaatgatgcgggtattattggcgcagcttggttagctttaccaaca
gaagattaa

DBGET integrated database retrieval system