KEGG   Listeria welshimeri SLCC5334: lwe1354Help
Entry
lwe1354           CDS       T00422                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lwe  Listeria welshimeri SLCC5334
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:lwe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lwe00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lwe00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lwe00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lwe00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lwe00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1345289..1346257
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKDGDIQEKWTIDTNIEDKGSHIVKDIGDSINQKLTDLQL
DNDNFYGIGMGTPGTVNYETGTVKGAYNLGWAEEQNISEDLEKITGLTIRLDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGVRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDFAKEFNGESKLKKAIENQENITSKLIFELGAEGDELATET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKNYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPTED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcggtacaaccgcaaaattagctatttta
acaaaagatggagatattcaagagaaatggacgattgatactaatatcgaagacaaaggt
tctcatattgtaaaagatattggtgactccattaatcaaaaactaactgatttacagctt
gataatgacaatttttacggaattggaatgggaacacccggaactgtcaattatgaaact
ggaactgtaaaaggtgcttataatctaggttgggcagaagagcagaatattagcgaagac
ttagaaaaaattaccggcttaacaatcagattggacaatgatgctaacgtagctgctctt
ggtgaacgttggaagggtgcaggagaaggcggagcaaacgttgtatttgttacacttgga
actggcgttggcggcggaatttttgcagaaggaaagattttacatggtgtacgtggtgca
gctggtgaaattggccatgtaacagtagttccagaaaatggttatgactgtacatgtggt
aaaaaaggttgtttagaaactgtagcatctgcaactggtattgttcgtgttgcaaaagat
ttcgcaaaagagtttaatggtgaatccaaacttaaaaaagcaattgaaaatcaagaaaat
attacatctaaattaatttttgagttaggtgctgaaggcgatgaattagcaacagaaaca
attgacaaaatttcgttttacttagctcttgcgcttagtcatataggaaacatgttaaat
ccagaaaaaattattattggtggcggcgtttcagcagcaggagatcaactattgacgcca
gttaaaaattattttgaaacgatggtatttccagcagttaaagagtcgaccaagttatct
attgcaacaaaaggaaatgatgcgggtattattggcgcagcttggttagctttaccaaca
gaagattaa

DBGET integrated database retrieval system