KEGG   Listeria welshimeri: lwe1354Help
Entry
lwe1354           CDS       T00422                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lwe  Listeria welshimeri
Pathway
lwe00010  Glycolysis / Gluconeogenesis
lwe00052  Galactose metabolism
lwe00500  Starch and sucrose metabolism
lwe00520  Amino sugar and nucleotide sugar metabolism
lwe00521  Streptomycin biosynthesis
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01120  Microbial metabolism in diverse environments
lwe01130  Biosynthesis of antibiotics
lwe01200  Carbon metabolism
Module
lwe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lwe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lwe1354 (glcK)
   00052 Galactose metabolism
    lwe1354 (glcK)
   00500 Starch and sucrose metabolism
    lwe1354 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    lwe1354 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lwe1354 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    lwe1354 (glcK)
Enzymes [BR:lwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     lwe1354 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: CAK20772
UniProt: A0AIE0
Position
1345289..1346257
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKDGDIQEKWTIDTNIEDKGSHIVKDIGDSINQKLTDLQL
DNDNFYGIGMGTPGTVNYETGTVKGAYNLGWAEEQNISEDLEKITGLTIRLDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGVRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDFAKEFNGESKLKKAIENQENITSKLIFELGAEGDELATET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKNYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPTED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcggtacaaccgcaaaattagctatttta
acaaaagatggagatattcaagagaaatggacgattgatactaatatcgaagacaaaggt
tctcatattgtaaaagatattggtgactccattaatcaaaaactaactgatttacagctt
gataatgacaatttttacggaattggaatgggaacacccggaactgtcaattatgaaact
ggaactgtaaaaggtgcttataatctaggttgggcagaagagcagaatattagcgaagac
ttagaaaaaattaccggcttaacaatcagattggacaatgatgctaacgtagctgctctt
ggtgaacgttggaagggtgcaggagaaggcggagcaaacgttgtatttgttacacttgga
actggcgttggcggcggaatttttgcagaaggaaagattttacatggtgtacgtggtgca
gctggtgaaattggccatgtaacagtagttccagaaaatggttatgactgtacatgtggt
aaaaaaggttgtttagaaactgtagcatctgcaactggtattgttcgtgttgcaaaagat
ttcgcaaaagagtttaatggtgaatccaaacttaaaaaagcaattgaaaatcaagaaaat
attacatctaaattaatttttgagttaggtgctgaaggcgatgaattagcaacagaaaca
attgacaaaatttcgttttacttagctcttgcgcttagtcatataggaaacatgttaaat
ccagaaaaaattattattggtggcggcgtttcagcagcaggagatcaactattgacgcca
gttaaaaattattttgaaacgatggtatttccagcagttaaagagtcgaccaagttatct
attgcaacaaaaggaaatgatgcgggtattattggcgcagcttggttagctttaccaaca
gaagattaa

DBGET integrated database retrieval system