KEGG   Listeria welshimeri SLCC5334: lwe1546Help
Entry
lwe1546           CDS       T00422                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lwe  Listeria welshimeri SLCC5334
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lwe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1545854..1546459)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGKVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGSEAQVFLYQHVREDNISLF
GFQSTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLITAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVFKAPENDIVHGLSPQLEEAVLALEALGYSTKELKKVIPKL
SKENDLTSDAYIKLALRLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaaagttacaacaattacacctgaatatatagttgtcgaa
gctggacaaattggctatcaaataattacaggaaacccgttttcctttcaacgattagaa
ggatcagaagcacaagtgtttttatatcagcatgtgcgggaagacaatatttctttgttc
ggttttcaatcaacagaggaacgttacttattcaaaaagctactaagtgtttctggaatt
gggccaaagagcgccttagcaattattgcttctggagatgttgtgccgcttattacagcg
attgaatcagaagatgatgtttatttaacaaagttcccaagtgttggcaaaaaaacggcg
cgccaaattatccttgatttaaaaggaaaattggccgatgttgttgctagtgaaattgtc
tttaaagctccagaaaacgatatcgttcatgggctttctccgcaattagaagaagcagtt
ttagcactagaagcattaggctacagcacgaaagagcttaaaaaagtaattccaaaacta
tctaaagaaaatgacttaacgagtgatgcatatatcaagctagcactacgattaatgaca
aaatag

DBGET integrated database retrieval system