KEGG   Listeria welshimeri: lwe1584Help
Entry
lwe1584           CDS       T00422                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lwe  Listeria welshimeri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lwe1584 (pfk)
   01230 Biosynthesis of amino acids
    lwe1584 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lwe1584 (pfk)
   00030 Pentose phosphate pathway
    lwe1584 (pfk)
   00051 Fructose and mannose metabolism
    lwe1584 (pfk)
   00052 Galactose metabolism
    lwe1584 (pfk)
  Energy metabolism
   00680 Methane metabolism
    lwe1584 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    lwe1584 (pfk)
Enzymes [BR:lwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     lwe1584 (pfk)
Protein phosphatases and associated proteins [BR:lwe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     lwe1584 (pfk)
Messenger RNA biogenesis [BR:lwe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     lwe1584 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1587643..1588602)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLENRGGLAVGIRENRIVENNIGEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgtgctgttgtacggaaagcaatctatgaaggacttgaagtttatggaattaactatggc
tttttagggctagtcaatggtgatatccgtaaattagaattaggttctgttggtgattta
cttcaccgcggtggtaccttcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggcctagtggttatc
ggtggagatggttcttatcatggagcggaagcacttacaaaacgcggcttcccaactatt
ggtatcccaggaacaattgataatgatatttctggaactgattttactatcggttttgat
acagcgctaaacactgttttagatgcacttgataaaatccgcgatacagcgacaagtcat
gaacgtacttttattattgaagttatgggtcgtgacgctggtgatatcgcactttggtct
ggacttgctggtggcgctgaagctatcatcgttccagaagaaagctttaatatggatgat
gtcgtggatcgtttaaacaagggtcgcgaacgtggtaaaaaacatagtattatcgttgtt
gcagaaggcgtaatgtctggtaatgaatttgccaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacatgttcaacgtggtggtagcccaactgcatttgac
cgtgtacttgcaagccgtcttggcgcgcgtgcggttgaattattattagaaaaccgcgga
ggattagctgttggaatccgtgagaatagaattgtcgaaaataatattggtgaaatttta
aaagaaaaacacacacttgatcaaaaactatttgatcttgcatctattttgtcgatttaa

DBGET integrated database retrieval system