KEGG   Listeria welshimeri: lwe1643Help
Entry
lwe1643           CDS       T00422                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lwe  Listeria welshimeri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lwe1643 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lwe1643 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lwe1643 (trpA)
Enzymes [BR:lwe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lwe1643 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1648856..1649629)
Genome map
AA seq 257 aa AA seqDB search
MTKTLTKKISNKKHAAVVTYIMGGDGGLDNLEEQLLFLEKSGVSAIEIGIPFSDPVADGP
IIQLAGLRALKKQVSLEAILNKLATSQVQIPLIIMSYINPIFHLGIPKFVEMVQKTPVKG
LIIPDLPYEHQTLITPELEGTDIALIPLVSLTSPKERLKEIAKQAEGFIYAVTVNGTTGV
RNKFDTHIDTHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHENKK
AELGTFLQKAAEVRIEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacaaaaaaaatatcgaataaaaagcatgctgctgtggttacttac
attatggggggagatggtggtttagataatttagaagaacagttattattccttgaaaaa
tcaggtgtaagcgcgattgaaattgggattccgttttctgacccagttgccgatggtcca
attattcaacttgcaggattgcgagctttaaaaaagcaagttagcctagaagctatttta
aataaactagcaacgagtcaagtgcaaattccgctaattattatgagctacattaatccg
atttttcatttaggaattccaaaatttgttgaaatggtacaaaaaacaccagtaaaagga
ctaattatacctgatttaccttatgaacatcaaacgcttattacgccagaacttgaagga
acagatattgcgctcattccactcgtttcccttacaagtcccaaagagcgcctgaaagaa
attgctaaacaagcagagggttttatttatgctgtaacagtgaatggaacaacaggtgtc
agaaataaatttgatacacatatagatacacatttagcttatttaaaaagtattagtcca
gttccagttcttgccggttttggtgtctcttctattgaacatgtggaaaaatttgcgcat
gtatgtgatggtgtgattatcggaagcaaagtggtgcaaatgttacatgaaaataaaaaa
gcagaactaggaacgtttttacaaaaggcagcagaagttcgaatcgaaaactaa

DBGET integrated database retrieval system