KEGG   Listeria welshimeri: lwe1643Help
Entry
lwe1643           CDS       T00422                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lwe  Listeria welshimeri
Pathway
lwe00260  Glycine, serine and threonine metabolism
lwe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01130  Biosynthesis of antibiotics
lwe01230  Biosynthesis of amino acids
Module
lwe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lwe1643 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lwe1643 (trpA)
Enzymes [BR:lwe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lwe1643 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAK21061
UniProt: A0AJ79
Position
complement(1648856..1649629)
Genome map
AA seq 257 aa AA seqDB search
MTKTLTKKISNKKHAAVVTYIMGGDGGLDNLEEQLLFLEKSGVSAIEIGIPFSDPVADGP
IIQLAGLRALKKQVSLEAILNKLATSQVQIPLIIMSYINPIFHLGIPKFVEMVQKTPVKG
LIIPDLPYEHQTLITPELEGTDIALIPLVSLTSPKERLKEIAKQAEGFIYAVTVNGTTGV
RNKFDTHIDTHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHENKK
AELGTFLQKAAEVRIEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacaaaaaaaatatcgaataaaaagcatgctgctgtggttacttac
attatggggggagatggtggtttagataatttagaagaacagttattattccttgaaaaa
tcaggtgtaagcgcgattgaaattgggattccgttttctgacccagttgccgatggtcca
attattcaacttgcaggattgcgagctttaaaaaagcaagttagcctagaagctatttta
aataaactagcaacgagtcaagtgcaaattccgctaattattatgagctacattaatccg
atttttcatttaggaattccaaaatttgttgaaatggtacaaaaaacaccagtaaaagga
ctaattatacctgatttaccttatgaacatcaaacgcttattacgccagaacttgaagga
acagatattgcgctcattccactcgtttcccttacaagtcccaaagagcgcctgaaagaa
attgctaaacaagcagagggttttatttatgctgtaacagtgaatggaacaacaggtgtc
agaaataaatttgatacacatatagatacacatttagcttatttaaaaagtattagtcca
gttccagttcttgccggttttggtgtctcttctattgaacatgtggaaaaatttgcgcat
gtatgtgatggtgtgattatcggaagcaaagtggtgcaaatgttacatgaaaataaaaaa
gcagaactaggaacgtttttacaaaaggcagcagaagttcgaatcgaaaactaa

DBGET integrated database retrieval system