KEGG   Listeria welshimeri: lwe2222Help
Entry
lwe2222           CDS       T00422                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lwe  Listeria welshimeri
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lwe2222 (gpm)
   01230 Biosynthesis of amino acids
    lwe2222 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lwe2222 (gpm)
  Energy metabolism
   00680 Methane metabolism
    lwe2222 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lwe2222 (gpm)
Enzymes [BR:lwe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     lwe2222 (gpm)
Exosome [BR:lwe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   lwe2222 (gpm)
  Exosomal proteins of melanoma cells
   lwe2222 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2259513..2260202)
Genome map
AA seq 229 aa AA seqDB search
MKLVLIRHGQSEWNKLNLFTGWHDVDLSEEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRA
IKTLNYVLEESDQMWVPVNKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLP
PLLEENDERQAKNDRRYQLLDTHAIPSGENLKVTLERVIPYWMDTIAPEIKEGRRVVIAA
HGNSLRALVKFLEGISDDEIMELEIPTGVPLVYELNDDLKPVNKYYLDK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattaattcgtcatggtcaaagtgaatggaacaaattgaatttatttaca
ggttggcatgatgttgacttgtcagaagaaggcgttgtagaagcaatgactgctgggaaa
aggattaaagaagctggcttagaatttgatgtagctttcacttccgttttgacaagagct
attaaaacacttaattatgttttagaagaatctgatcaaatgtgggtaccagtcaacaaa
tcatggcgtttaaacgaacggcattacggagcactccaaggacttaataaacaagaaact
gctgaaaaatatggtgctgaccaagtgcaaaaatggcgtagaagttatgatacgcttcca
ccacttttagaagaaaacgacgaaagacaggctaaaaatgatcgccgttatcaattacta
gatacacatgcaattccatcaggcgaaaacttaaaagtaactttagaacgtgttattcct
tactggatggataccattgctccagaaattaaagaaggtcgcagagtagtgattgcagcg
cacggtaatagtttacgagcattagtaaaattcctagaaggtattagtgatgatgaaata
atggagttagaaattccaacgggtgtaccacttgtttacgaattaaatgatgatttaaaa
ccagtaaataaatattacttggacaaataa

DBGET integrated database retrieval system