KEGG   Listeria welshimeri: lwe2222Help
Entry
lwe2222           CDS       T00422                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lwe  Listeria welshimeri
Pathway
lwe00010  Glycolysis / Gluconeogenesis
lwe00260  Glycine, serine and threonine metabolism
lwe00680  Methane metabolism
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01120  Microbial metabolism in diverse environments
lwe01130  Biosynthesis of antibiotics
lwe01200  Carbon metabolism
lwe01230  Biosynthesis of amino acids
Module
lwe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lwe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lwe2222 (gpm)
  Energy metabolism
   00680 Methane metabolism
    lwe2222 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lwe2222 (gpm)
Enzymes [BR:lwe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     lwe2222 (gpm)
Membrane trafficking [BR:lwe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    lwe2222 (gpm)
Exosome [BR:lwe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   lwe2222 (gpm)
  Exosomal proteins of melanoma cells
   lwe2222 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sugar-bind
Motif
Other DBs
NCBI-ProteinID: CAK21640
UniProt: A0AKV8
Position
complement(2259513..2260202)
Genome map
AA seq 229 aa AA seqDB search
MKLVLIRHGQSEWNKLNLFTGWHDVDLSEEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRA
IKTLNYVLEESDQMWVPVNKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLP
PLLEENDERQAKNDRRYQLLDTHAIPSGENLKVTLERVIPYWMDTIAPEIKEGRRVVIAA
HGNSLRALVKFLEGISDDEIMELEIPTGVPLVYELNDDLKPVNKYYLDK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattaattcgtcatggtcaaagtgaatggaacaaattgaatttatttaca
ggttggcatgatgttgacttgtcagaagaaggcgttgtagaagcaatgactgctgggaaa
aggattaaagaagctggcttagaatttgatgtagctttcacttccgttttgacaagagct
attaaaacacttaattatgttttagaagaatctgatcaaatgtgggtaccagtcaacaaa
tcatggcgtttaaacgaacggcattacggagcactccaaggacttaataaacaagaaact
gctgaaaaatatggtgctgaccaagtgcaaaaatggcgtagaagttatgatacgcttcca
ccacttttagaagaaaacgacgaaagacaggctaaaaatgatcgccgttatcaattacta
gatacacatgcaattccatcaggcgaaaacttaaaagtaactttagaacgtgttattcct
tactggatggataccattgctccagaaattaaagaaggtcgcagagtagtgattgcagcg
cacggtaatagtttacgagcattagtaaaattcctagaaggtattagtgatgatgaaata
atggagttagaaattccaacgggtgtaccacttgtttacgaattaaatgatgatttaaaa
ccagtaaataaatattacttggacaaataa

DBGET integrated database retrieval system