KEGG   Listeria welshimeri SLCC5334: lwe2474Help
Entry
lwe2474           CDS       T00422                                 

Gene name
murA-1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lwe  Listeria welshimeri SLCC5334
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lwe00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lwe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2514193..2515485)
Genome map
AA seq 430 aa AA seqDB search
MEKIIVRGGKQLNGSVKMEGAKNAVLPVIAATLLASKGTSILKNVPNLSDVFTINEVLKY
LNADVSFVNDEVTVDATGDITSDAPFEYVRKMRASIVVMGPLLARTGSARVALPGGCAIG
SRPVDLHLKGFEAMGAIVKIENGYIEATAEKLVGAKVYLDFPSVGATQNIMMAATLAEGT
TVIENVAREPEIVDLANFLNQMGARVIGAGTEVIRIEGVKELTATEHSIIPDRIEAGTFM
IAAAITGGNVLIEDAVPEHISSLIAKLEEMGVQIIEEDNGIRVIGPDKLKAVDVKTMPHP
GFPTDMQSQMMVIQMLSEGTSIMTETVFENRFMHVEEMRRMNADMKIEGHSVIISGPAKL
QGAEVAATDLRAAAALILAGLVADGYTQVTELKYLDRGYNNFHGKLQSLGADVERVDDSK
IDINNLASLF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaattattgtgcgcggtggaaaacagttaaatggttctgtgaaaatggaaggt
gccaaaaatgctgtattaccggtaatagctgctactttacttgcgagtaaaggtactagc
atattaaaaaatgtcccaaatttgtctgatgtatttacaattaatgaggttcttaaatat
ctaaatgcagatgtttcctttgtaaatgatgaagtaacagttgatgcaacaggagatata
acttctgatgcaccttttgagtatgtgcgtaaaatgcgtgcttccattgttgtgatgggt
ccacttctagcccgtactggttcagctcgtgtagctttaccaggtggatgtgcaattggt
tcaagaccagttgatttacatttaaaaggcttcgaagctatgggtgcgatagtgaaaatt
gaaaacggctatattgaagcaactgctgaaaaattagttggagctaaagtctacttagat
ttcccaagtgtaggggcaactcaaaatattatgatggcagctactttagcagaaggaaca
actgtcattgagaatgttgcgcgtgaacccgaaattgttgacttagctaacttccttaat
caaatgggagctcgagttattggtgcgggtacggaagtaattagaattgaaggagttaaa
gagctaacagcaactgaacattctattattccagaccgtattgaagcaggtacatttatg
atagctgcagcaattactgggggaaatgttttaattgaagatgcagttccagaacatatt
agttcactaatagctaaattagaagaaatgggcgttcaaatcattgaagaagataacggt
attcgagttattggcccagataaattaaaagctgttgatgttaaaactatgccacatcca
ggcttcccaacggatatgcaatcacaaatgatggttatccaaatgttaagtgaaggcaca
agtattatgactgaaactgtttttgaaaatcgctttatgcatgtagaagaaatgcgtaga
atgaatgccgatatgaaaattgaaggccattctgttattatttcaggaccagctaaattg
caaggcgctgaagttgcagcaacggatttacgagcagcagcagcacttattcttgcagga
ttagttgcagatggatatacacaagtcactgaattaaaataccttgatagaggatacaat
aatttccacggaaaacttcaatcacttggagcagatgtagaacgtgttgatgattccaaa
attgatattaataatttagcatcgttattttaa

DBGET integrated database retrieval system