KEGG   Listeria welshimeri: lwe2495Help
Entry
lwe2495           CDS       T00422                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lwe  Listeria welshimeri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lwe2495 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lwe2495 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lwe2495 (thrC)
Enzymes [BR:lwe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lwe2495 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2532399..2533454)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVNEKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWNLAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPVSHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaaatgaaaaaacgcca
atgatctcacttgcggaaggaaatacaccacttattccattgccaaatttgtccaaagag
cttggagtgactttatatggaaaatatgaagggttaaatccaactgggtcttttaaagat
cgtggcatggttatggctgttgctaaagcgaaagaagaaggagctgaagcagttatttgt
gcatcgactggtaatacttctgccgcagctgcagcatatgcaacacgtgcgggtttaaaa
gcttatattgtcattccagaaggcaaagtagctctaggaaaattagcgcaagcagtcatg
tatggagcagatattatctcgattcaaggcaattttgatgaagcgttaaaatcggtgcgt
gaactggctgaaacagaagcggtaacccttgtaaactcagtgaatccttatcgtttagaa
ggtcaaaaaacagctgcctttgaaatttgtgagcaactaggttctgctccagacgttctt
gcaattccagttggtaacgccggaaatatttctgcatactggaaaggctttaaagagtgg
aatgaggctaaagcttctggacttccgcggatgcatggatttgaagcagaaggagcggct
gcaattgttcaagggaagccaattgataatccagaaacgattgcaacagcgattcgtatt
ggaaatccagctagttggaatcttgccgaagcagctcgcgatgaatctggtggctacatt
cattctgtaaccgatgacgaaatcgttaatgcttataaaaaaattgccgcacaagatggt
gtttttatcgagccaggttctgctgcttcattagctggtgttatccaacatgtagctaac
ggaacaattaaaaaaggtgaaacagtcgtttgtgtatttactggaaatggcttaaaagat
ccagatactgcaatgagtgtacatgaaatcccggtttctcatgtcgatgatatcgaagca
atgcgtacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system