KEGG   Listeria welshimeri: lwe2672Help
Entry
lwe2672           CDS       T00422                                 

Gene name
acsA
Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lwe  Listeria welshimeri
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lwe2672 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lwe2672 (acsA)
   00620 Pyruvate metabolism
    lwe2672 (acsA)
   00640 Propanoate metabolism
    lwe2672 (acsA)
  Energy metabolism
   00680 Methane metabolism
    lwe2672 (acsA)
Enzymes [BR:lwe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     lwe2672 (acsA)
Lipid biosynthesis proteins [BR:lwe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   lwe2672 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2703259..2704836
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNDHDETKTWSYRHLLEQANKFANVVKNAG
VKKGDHVIVMTPRALETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYSG
MTAEFDKIEKIPSVSKKIIVGGKLSGWDHYETLMDSASTDFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYSGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNHLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFNIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDADGNPVG
VGEIGDIAMRKDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTEDLVHELQ
TFTKEQTAPYKYPRRIEFVESLPKTDSGKIRRVELRDAEFASVNK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagagaacctaattgctccagaactttataatatcaccgacgagattgctaaa
tttagttctgaaaaaactgccttaatttggaagaatgaccacgatgaaacaaaaacttgg
agttatcgtcacctgcttgaacaagcgaataaatttgctaatgtggtaaaaaatgctggt
gttaaaaaaggagatcacgtcattgttatgacacctagagcacttgaaacttacgccatc
tatatgggtttgtggaaagctggggctattatcattcccgcatccgaactacttaaagcc
catgatttagaataccgtattcaccacgcaaacgtaaaagcaatcgtttcttacagcgga
atgacagcagaatttgataaaattgaaaaaattccttctgtatcgaaaaaaattattgtt
ggtggcaaattatccggctgggatcattatgaaacattaatggattcggcttctactgat
tttgaacgcgtagaaacttctcgcgatgatgcttgcctgcttgctttcacaagtggcaca
actggtaatcctaaaggggttgtacatattcatggttggggttatgcacatattcgtatt
gcagctgatcattggctcgatattcatgaagatgatatcgtctgggctacagcaggacct
ggttggcaaaaatgggtttggtctcctttcctttctgtacttggaaaaggcgcgaccggt
tttatttacagcggtcgtttcattcctgaaaaacaacttcatttactagaagaagaaaaa
attaacgtactatgttgtacgccaacggaatatcgcttaatggcaaaagtaaatcattta
cgtgaacatgatttaagttcgcttcgtagcgccgtttcagcaggagaacctttaaaccga
gaagttattcaagttttccaagataattttaacattaaagtccgtgatggctacggtcag
acggaaagtacccttttgattggaacacttgttgatacaccaattcgtcctgggtcaatg
ggtaaaccaattatgcctgaatacatggcgattattgatgcagatggaaatcctgtcggg
gttggcgaaattggtgatatcgctatgcgtaaagacttcccggcacttttcaaagagtat
tataaggaacccgaacgcttgcaaaaagcgattcgtggtgattattttgtttctggtgac
cgtgcaatccgtgatgaagataattattactggttccaaggccggaatgatgacattatt
attagctccggatacaccatcggaccatttgaagttgaggacgcgctcacacatcacccc
gctgtaaaagaagtcgctgttgtcgcaagtcctgacgaaatccgtggtactgttgtaaaa
gcgttcatcgttttaaaagatggatacgagggcaccgaggatcttgttcatgaattacaa
acatttacaaaagaacaaactgctccatataaataccctcgccgaattgaatttgttgag
tcattaccgaaaactgattctggtaaaattcgccgcgtcgagttgcgtgatgcggagttt
gctagtgttaataaataa

DBGET integrated database retrieval system