KEGG   Listeria welshimeri SLCC5334: lwe2708Help
Entry
lwe2708           CDS       T00422                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lwe  Listeria welshimeri SLCC5334
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lwe00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2742973..2744427
Genome map
AA seq 484 aa AA seqDB search
MEHNKLKPFPKDFLWGSASAAYQVEGAWNEDGKGPSVWDEFVRIPGTTFKETNGDVAVDN
YHRYKEDVALMVEQGLKAYRFSVAWSRVVPHGNGEVNEAGLKFYDNLIDELLSYGIEPVV
TLYHWDIPQGLQDEYGGWESRKVVEDFTNYAALLFDRFNGRVKYWVTLNEQNVFISHGYK
LAYHPPGVSDDKRMFAANHNANLANASAIAKFRELGTSGKIGPSFAYGPSYSIDANPANV
LASENSEEFNAHFWMDVYTWGEYPTATWNWLEEHGLAPEILPGDTELLKKGKPDFMGVNY
YRSMTHAFNGKDGVGSGKMNTTGEKGTSEETGVPGLYKNTNNPYLEKTNWDWDIDPTGLR
IGLRRITNRYKLPIMITENGLGEYDSLTEDHKIHDEYRIEYIRAHALAIQEAITDGVEML
GYCTWSFTDLLSWLNGYQKRYGFVYVDRDENDEKELKRYKKDSFYWYKKTIEANGANLVE
EQGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaacataataagttgaaacctttcccaaaagattttctatggggatcagcttctgca
gcgtatcaagtagaaggtgcctggaatgaggatggcaaaggaccatctgtatgggatgaa
tttgttcgtattcctggaacaacatttaaagaaacaaacggcgatgtagcggtggataat
taccatcgttataaagaagacgtagcgctaatggttgaacagggtctaaaagcatatcgc
ttttctgtcgcatggagtcgcgttgtcccgcatggtaacggggaagttaacgaagctgga
cttaaattctatgataatttaattgatgaacttctttcttatgggattgagccagtcgtt
acactttatcattgggatattccgcaagggcttcaagatgaatatggtggatgggaatcg
cgcaaagttgtagaagatttcactaactacgctgcccttctattcgatcgctttaatggc
cgagttaagtactgggtaacccttaatgaacaaaatgtatttatctcacatggttacaaa
ttagcgtatcacccgcctggcgtttctgatgacaagcgtatgtttgcagcaaatcataat
gcgaacttggcgaatgcttctgcaattgctaaattccgcgagttaggtacttctggaaaa
attggaccaagttttgcatatggaccaagttactccattgatgctaacccagcgaatgtt
ctcgcttctgaaaactccgaagaattcaatgctcatttctggatggatgtttacacatgg
ggtgaatatcctaccgctacttggaactggctggaagagcacggtctagcaccagaaatc
ttaccaggtgatacagaacttctgaaaaaaggaaaacctgatttcatgggagttaactat
tatcgctccatgacgcatgcatttaatggaaaagacggtgttggttctggaaaaatgaat
acaactggcgaaaaaggcacttccgaggaaactggtgtaccggggttatataaaaacacc
aataatccttacttagagaaaacgaattgggactgggatattgatccaactggcttgcgc
attggcttacgtagaattactaaccgctataaattaccaatcatgattacagaaaatggt
cttggcgagtatgatagcctaacggaagaccataaaatccatgatgagtaccggattgaa
tacattcgtgcacatgcactagcaatccaagaagcaatcacggacggcgtagagatgctc
ggttactgcacttggagtttcacagatttactaagttggttaaatggttaccaaaaacgt
tacggtttcgtctatgttgaccgtgacgaaaatgatgaaaaagaattaaaacgctacaaa
aaagacagtttttactggtataaaaagacaattgaagcaaacggagctaatttagtagaa
gaacagggcaaataa

DBGET integrated database retrieval system