KEGG   Listeria welshimeri SLCC5334: lwe2718Help
Entry
lwe2718           CDS       T00422                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lwe  Listeria welshimeri SLCC5334
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lwe00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2753550..2754998)
Genome map
AA seq 482 aa AA seqDB search
MSNTKFPDGFMWGGATAANQFEGGYNLGGKGLACADLFTGGTHTEPRRITAKLEESTFYP
SHEAVDFYHHYKEDIRLMAEAGFKVFRMSINWTRIFPTGKEAEPNEEGLQFYEDVFNELK
KYQIEPLVTIAHFDIPLALTNEVNGWASRDLIDYYLHFCEVIFKRYKHLVKHWLTFNEIN
TSTMEIGNYLSLGIRHAEGDFLHQKDDPTVRYQALHHQFVASAKAVKLGHSINPDFMIGC
MIAYMPRYPRTCEPSDVLLAKQTEAMHSHFCGDVHVKGYYPFYANTYFKDNGITIEFAPE
DEQVLREGTVDFYTFSYYLTLCASNDPAYKNSGKSVIGGAENPYLKTNDWGMQTDPVGLR
IALNDLYTRYNIPLMVVENGLGAFDKLEDDGTINDPYRIDYFKEHILQMHKAIQDGVDLI
GFTIWGCIDLVSASTGEMAKRYGIIYVDKYDDGTGDYSRKKKASYYWYKDVISSNGENGL
EE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatacaaagtttccagatggttttatgtggggcggggcgaccgcggccaatcaa
tttgaaggtggctataatttaggaggcaaagggcttgcttgtgcggatctatttacaggt
ggaacgcacacagaaccgagaagaattacggcaaagttagaagaatccactttttatcca
agtcatgaagctgttgatttttaccatcattataaagaagatattaggttaatggcagag
gctggatttaaagtattccggatgtcgataaactggacccgtattttcccaactggaaaa
gaagcagagcctaatgaggaaggattgcagttttatgaagatgtttttaacgaattaaaa
aaataccaaattgaaccactagtgacgattgctcattttgatattccgttagcattaaca
aatgaggtaaacggttgggcgtcgcgcgatttgattgattattatcttcatttttgcgaa
gtgatttttaaacgttataagcatttagtaaaacattggttgacatttaacgagattaat
acttcaacaatggaaattggtaattatttatcgcttgggattcgtcatgcggagggagat
tttcttcatcaaaaagacgatccgacagtacgataccaagcgcttcatcaccaatttgtt
gctagtgcaaaagcagtaaaacttggacatagtattaatccggacttcatgattggctgt
atgattgcatatatgccacgttatccgcgcacttgcgaaccatccgacgtcttgctagct
aagcaaaccgaagcaatgcacagccatttctgtggcgatgtccatgtcaaaggttattat
cctttttatgcaaacacatactttaaagataatggtattacgattgaatttgcaccagaa
gatgagcaagttttgcgcgaaggaacagttgatttttacacatttagttattatttaaca
ctttgtgcgtccaacgatccagcttataaaaattcgggtaagagtgttatcggtggtgct
gaaaatccttatttaaaaacaaatgattggggaatgcagacggacccagtaggacttcgg
attgcgcttaatgacttatatactcgctataatattccgcttatggtggtagaaaatggc
ttaggcgcttttgacaaattagaagacgatgggacaattaatgatccatatcgtattgat
tatttcaaagagcacattctccaaatgcataaagcgattcaagatggtgttgatttgatt
ggctttactatatggggttgtatcgaccttgtaagtgcatctacaggcgaaatggcaaaa
cgttatggcattatctatgttgataaatatgacgatggaacaggcgattattcacgtaaa
aagaaagcatcttattattggtataaagatgttattagctcgaatggtgaaaatggatta
gaggagtaa

DBGET integrated database retrieval system