KEGG   Listeria welshimeri: lwe2770Help
Entry
lwe2770           CDS       T00422                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
lwe  Listeria welshimeri
Brite
Enzymes [BR:lwe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     lwe2770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: CAK22188
UniProt: A0AMF6
Position
complement(2803222..2804919)
Genome map
AA seq 565 aa AA seqDB search
MNLRKRLSRLYAEEVVESLAARIEARVQQTKQRKLARKDMWDEKDIVLITYGDQFKEESQ
KTLTTFKKMYDSYLKSTFEVVHFLPFYPYSSDDGFSVIDYKAVNPELGDWEDIQEMEKSA
RLMFDFVCNHMSAKSEWFKRYLAGDEEFRNFFVEMNPDTDLSAVTRPRATPVLTPFQFDS
GKVGHIWTTFSEDQIDLNFASSEVLYKMIDVLMFYLEEGAEYVRLDAVGFMWKVPGTSSI
HLEETHEIVKLFRDLVDIAAPGTIIITETNVPHVDNISYFGNGEKEAHMVYQFPLPPLVL
HAIHHGNAGFLSNWARNLELPEGKRTFFNFLASHDGIGLNPVRGIIPEAEILALVDDLEK
EGALVSYKQNPDGTKSPYEINVTYMDALSERGDTDDLRLARFLVAHAVLMSIPGVPAVYI
QSILGSRNDYLGVEKTGHNRSINRKKYHLAEITAELEQADSLRKGTYDALTKLISTRKAE
SLFHPEIPMEVLESTAELFVIKRSSGAESIILIHNLSEQEVSYSLDSGVYTNLYTGSTIT
GSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaagaaaacgactttcgcggttatatgccgaagaggtggtagaaagtttagcc
gcaagaatcgaagcacgggtacagcaaacgaaacaacgaaagttagcgcgaaaagatatg
tgggatgagaaagatatagttttaattacatatggagatcaatttaaagaagaatcccaa
aaaacattaacaacttttaagaaaatgtatgatagttatttaaaatcgacttttgaggta
gttcatttcttgcctttttatccttattcgtcggatgatggattttccgtcattgattat
aaggcagtgaatccggagcttggggattgggaagatattcaggaaatggaaaagtcggcg
cggttgatgtttgattttgtttgtaatcatatgtcagcaaaaagtgagtggtttaagcgg
tatttagctggtgatgaggaatttcgaaatttctttgtggaaatgaatcctgacacggac
ctgagcgcggtgacaaggccgcgtgcaacacctgtactcacgccttttcaatttgattca
ggaaaagtaggtcatatttggacaacattcagtgaggatcaaattgatttaaactttgcc
agttcagaagttctttataagatgattgatgtattgatgttttatttagaagaaggcgcc
gaatatgtgcggctcgacgcggttggttttatgtggaaagttcccgggacaagttcgatt
catttagaagagacacatgaaatcgtgaaattatttagagatttagtggatatcgcagca
cctgggacaattattattactgaaacgaatgtgccgcacgtggataatattagctacttt
ggaaacggtgaaaaagaagcgcatatggtttatcagtttccacttccgccactcgtactt
cacgcgatacatcatgggaatgccgggtttttaagcaactgggcgcgaaatttagaatta
ccagaaggaaaacgcacattctttaatttccttgcttcacatgatggaattggtttaaac
ccagtgcgcggaattatcccagaagcagaaattttggctttagtggatgatttggaaaaa
gaaggagcactcgtttcgtataaacaaaatccagatggaactaaaagtccttacgaaatt
aatgtgacttatatggatgctttaagtgagcggggagatacggacgatttgagactggcg
agattccttgtagctcatgccgtactgatgtctattccaggagttccagctgtttatatt
caaagtattttaggaagcagaaatgattatttaggagtagaaaaaacagggcacaatcgc
tctattaatcgaaaaaaataccacttagcagaaatcacagctgaattagaacaggctgat
tccttacgaaaaggaacttatgatgcgttaacaaaattaattagtacacgaaaagcggaa
tcacttttccatccagaaatcccgatggaagttttagaatctacggcggaattgtttgtt
attaaacgatcatctggcgcggaatcgattatattgattcacaatttatcagaacaagaa
gtgagttattcactagacagcggtgtttatacaaatctttatacgggttccactataact
gggagcgattccataaagcttagtggctatgaattctgctggctaaaaaccaaaaattac
agggaggaacaaaaatga

DBGET integrated database retrieval system