KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx01060Help
Entry
Lxx01060          CDS       T00190                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lxx01060 (hemG)
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Lxx01060 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
103382..105214
Genome map
AA seq 610 aa AA seqDB search
MTSLGAELRQTIEADPTRIAVVGGGMAGLVAARECARPGFEVIVLEAADRIGGSVAPLEL
DGMTLDAGAESFATRGGHVAELLDELGLAGDVVSPNPAGAWVRTGTKSVPLPKAGLLGIP
SSPLASDVVAAIGWGGALRAYLDRLLPVLKIGQERRLGTLVRKRMGAKALHELVAPVVTG
VYSAAPDDLDIEVVAPGLNAALTRLGSLSGAVGELWSQAKAGSAVQGLRGGMWRLPAALA
ADFRARGGSVRTAAAVTAIEPWAASETHAPAGVAHPESDGGRRPARWTLRLADGTAIDTD
AVVMAAPAHAALALLPTASPSLAGLAGLDWPPASSVELVTLVLTTPAAAEAPRGTGVLVA
DAPGSGVTAKALTHASAKWAWVAEAAGDGCHVVRLSYGRAGQPGTRELGDQRLREIALAD
ASALLNIPLAVSDVAAFARILWTNALPYATVGQRERIQRVRDGVGSVEGLEVTGSWLTGT
GLASVVPDARQAAERARGSTLESTDRGHGGVRMRGKILFVAGAAVGYVLGARAGRKRYDQ
LKAAAARVWESPSVQKRVHAVEDFMAEKACEAPEAVFVAIKKAVVRVNERRREARSPIPE
PETAGDGSAS
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtctcggtgcggagctcagacagaccatcgaggccgacccgacccggatcgcc
gtcgtcggcggcggcatggccggtctcgtcgcggcgcgcgagtgtgcccggcccggcttc
gaggtgatcgtgctcgaggcggcggaccgcatcggcggttccgtcgcaccgctcgaactc
gacgggatgacgctcgacgccggcgcggagagtttcgcgactcgcggcggtcacgtcgct
gagctcctcgatgagctgggcctggccggggatgtcgtctcgccgaacccggcaggcgcg
tgggtgcgcaccggcacgaagagcgttccgctgccgaaggccgggctgctcggcatcccg
agctctccgctcgcgagcgatgtagtggccgccatcggctggggaggcgccctccgcgcc
tacctcgaccggctgctgccggtgctcaaaatcgggcaggagcgccggctgggaacgctc
gtgcggaagcggatgggcgcgaaagctctgcacgaactggtcgcccccgtcgtcaccggt
gtctactcggctgcgccggacgatctggacatcgaggtcgtggcccccggtctcaacgcc
gcgctgacccgccttggctcgctctccggagccgtcggcgaactgtggtcgcaggcgaag
gcgggaagcgctgtgcagggactccgcggcgggatgtggcggctccctgccgcgctcgcc
gccgacttccgcgcgcgcgggggcagcgttcgcaccgccgccgccgtcaccgcgatcgag
ccgtgggccgcgtccgagacgcatgcgcccgccggggtcgcgcatcccgaatcggacggc
ggacgccgacccgcccgctggacccttcgcctggccgatgggacggccatcgacacggat
gccgtggtgatggccgcgcccgcgcacgctgcgctcgcgctgctccccacggcatcccct
tcgctggccggtctggccggtctcgactggcctccggcgtcgagcgtcgaactggtcacc
ctcgttctcacaacgcccgctgccgccgaggcgcccagagggacgggcgtgctcgtcgcc
gacgcccccggctccggcgtcaccgccaaagccctcacgcatgcgagcgccaagtgggcg
tgggtcgcggaggccgcgggagacggctgccacgtcgtccgtctgtcgtacggccgggcg
ggccagccagggacccgcgagctgggcgatcagcgcctccgggagatcgcgctcgcggac
gcctctgccctactcaatattccgcttgcggtatccgatgtggctgcattcgcccggatt
ctctggacgaacgctcttccttatgcgacagtggggcagcgggagcgcatccagcgcgtt
cgcgatggcgtcggaagcgtcgagggtctcgaggtgaccggctcctggctgaccgggacc
gggctcgcctccgtcgtcccggatgcccgtcaggcagccgagcgggcgcgggggtctacg
ctggagagcactgaccgaggacatggaggggtgaggatgcgaggaaagatcctgttcgtc
gcaggagcggccgtcggctatgtgctcggcgcgcgggccgggcggaagcgctacgaccag
ctgaaggccgccgccgccagagtgtgggagtcgccttcggtgcagaagcgggtccacgcg
gtcgaggacttcatggcggagaaggcgtgcgaggcgccggaggccgtgttcgtcgccatc
aagaaggccgtcgtccgcgtgaacgagcgacggcgcgaggcgcgttcgccgatccccgag
ccggagacggcgggggacggaagcgcatcctga

DBGET integrated database retrieval system