KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx01110Help
Entry
Lxx01110          CDS       T00190                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lxx01110 (hemD)
Enzymes [BR:lxx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Lxx01110 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
108834..109616
Genome map
AA seq 260 aa AA seqDB search
MTTGSVPKPLAGWRVLVPRGGPWGDSVAADLRAVGASPVVAAMINFAPAADASALERALH
RLAAGEFDWVTITSATTVDVLSASRAVVPPRTRIAAVGETTAAALTAASYKMDLVPAEDN
SAHGLLAEWEAATQGQVPLRILTLRSDIAKPLLTEGLRRIGHDVDSVVAYRTIGVTVPES
VVADVRQGLVQAILVTSGSVAEQVQLQLGPIPESTLVAAIGPRTARDARDCGLRVDVVAE
ERTAAALIQAVVAVAASRVG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgggatcggtgccgaaaccgctcgccggctggcgtgttctggtcccgcgcggg
gggccgtggggcgactccgtggcggcggatctgcgagcggtgggcgcttcgccggtcgtc
gcggccatgatcaatttcgcgccggcggccgacgcctccgctctggagcgcgctctgcac
cgcctggccgccggcgagttcgactgggtgacgatcacgagcgcgaccacggtggatgtg
ctgagcgcgtcccgcgcggtcgtcccgccccgcacacggatcgccgccgtcggagagacc
acagccgctgcgctcaccgcggccagctacaagatggacctcgtgcccgcggaggacaac
tccgcccacggactgcttgcggagtgggaagccgcaacccagggccaggtcccgttgcgc
atcctcacgctccgttccgatatcgccaagcctctcctcaccgaggggttgcgccgtatc
gggcacgacgtcgattcggtcgtggcctaccgcacgatcggcgtgaccgtgccggagagc
gtggtcgcggatgtgcggcaggggctcgtgcaggcgatcctcgtcacgagcggctcggtg
gccgagcaggtgcagctgcagctcggccccattccggagtccacgctggtcgcggccatc
ggaccgcggacggcgcgcgacgcccgcgactgcggtctgcgggtggatgtcgtggccgag
gagcgcaccgccgccgcgctgatccaggcggtcgtggcggtggccgcctcccgtgtgggc
tga

DBGET integrated database retrieval system