KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx01120Help
Entry
Lxx01120          CDS       T00190                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lxx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
109644..110624
Genome map
AA seq 326 aa AA seqDB search
MSELHPVIRPRRLRQSPAMRRLVAETRLHPAELILPLFVREGLAEPRPVASMPGVVQHTL
DSLSRAASGAAEAGVGGVMLFGVPEMRDAAGSAATDPDGILNVATRTVAAEVGDALVVQT
DLCLDEFIDHGHCGVLDGAGAVDNDATLLRYRDMALAQVEAGSQLLGLSGMIDGQVAAVR
QALDAAGHTETVLLAYAAKYASGFYGPFRDAVDSPLVGDRRAYQQDPANRREGLREARLD
LDEGADILMVKPALSYLDVLSDVAAISEVPVWAYQVSGEYAMVEAAAANGWIDRDRIIEE
TLVGARRAGADAIVTYWATEVAGWQR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactgcaccccgtcatcagaccccgccgtctgcggcagtcgccggcgatgcgg
cgtctcgtggccgagacccggctgcaccccgccgagctgatcctccctctcttcgtgcgc
gagggcctggccgagccgcggccggtcgcgtcgatgccgggcgtggtccagcacacgctg
gactcgctgagtcgtgccgcctccggcgcggctgaggcgggcgtcggtggcgtcatgctg
ttcggtgtgccggagatgcgcgacgccgccggctccgccgcgaccgaccccgacggcatc
ctgaatgtcgcgacccgcactgtcgccgccgaggtgggcgacgcgctcgtcgtgcagacc
gatctgtgcctggacgagttcatcgaccacggccactgtggggtgctcgacggagccgga
gccgtcgacaacgacgcgactctgctgcgctaccgcgacatggcgctcgcgcaggtcgag
gccggctcccagctgctcggcctcagcggcatgatcgacggtcaggtcgccgccgtgcgc
caggcgctcgacgcggccggtcacacggagacggtgctcctcgcctatgctgccaagtac
gcttccggcttctacggccccttccgcgacgctgtcgactccccgctggtcggcgaccgc
cgtgcctatcagcaggacccggccaaccgccgagagggtctgcgcgaggcccgcctcgac
ctggacgagggtgcggacatcctcatggtgaagccggcgctgagctacctcgacgtgctc
agcgacgtcgccgccatcagcgaggtcccggtctgggcctaccaggtctccggcgagtac
gcgatggtggaggccgccgccgcgaacggctggatcgaccgcgaccggatcatcgaggag
acgctggtcggcgcccgccgcgcgggggccgatgcgatcgtgacctattgggcgaccgaa
gtggcggggtggcagcgatga

DBGET integrated database retrieval system