KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx03440Help
Entry
Lxx03440          CDS       T00190                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lxx03440 (recR)
DNA repair and recombination proteins [BR:lxx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Lxx03440 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Lxx03440 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 PHF5 HHH_3 HHH_8 Toprim_2
Motif
Other DBs
NCBI-ProteinID: AAT88360
UniProt: Q6AGY5
Position
341094..341690
Genome map
AA seq 198 aa AA seqDB search
MYAGIVQELIDELGRLPGIGPKSAQRIAFHILQTEAFDVTRLAEVLLEVRDKVRFCEICG
NVSEQATCSICRDPRRDPALICVVEEAKDVVAIERTREFRGLYHVLGGAISPIDGVGPDD
LRIRQLVQRLADGTVQEVIIATDPNLEGEATATYLSRLLTTLEVRVTRLASGLPVGGDLE
YADEVTLGRAFEGRRQVS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgcgggcatcgtccaggagctgatcgacgagctcggccgccttccggggatcggg
ccgaagtcggcgcagcggatcgcgttccacatcctgcagaccgaggcgttcgatgtcacc
cgcctggccgaggtgttgctggaagtgcgcgacaaggtgcggttctgcgagatctgcggc
aatgtctcggagcaggccacctgctctatctgccgcgatccgcgtcgcgacccggcgctg
atctgtgtcgtggaggaagcgaaggatgtcgtcgccatcgagcgcacgcgcgagttccgg
gggctctaccatgtcctcggcggcgccatcagcccgatcgatggcgtcggtcccgacgac
ctccgcatccggcagctcgtgcagcgtctcgccgacgggaccgttcaggaggtcatcatc
gcgaccgaccccaatctcgagggcgaggcgacggcgacctacctcagccgtctgctgacc
acgctggaggtccgcgtcacgcgcctcgcctccggtctgccggtcggcggcgatctggag
tacgccgacgaggtcaccctcggccgcgcgttcgagggccggcgtcaggtctcctga

DBGET integrated database retrieval system