KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx04420Help
Entry
Lxx04420          CDS       T00190                                 

Gene name
glpk
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lxx00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
443702..445222
Genome map
AA seq 506 aa AA seqDB search
MAEYIVAIDQGTTSTRAIIFDKSGSIVSTGQLEHEQIFPKPGWVEHNPVEIWNNTREVIG
QALSKADLTRHDIAAVGITNQRETAVVWDKNTGEPVYNAIVWQDTRTQPIVDRLAAEGGV
ERFKPIVGLPLATYFSGTKIVWILENVEGVRERAERGDLLFGTTESWVLWNLTGGTDGGV
HATDVTNASRTLFMDLETLSWRDDILDVFGVPKSMLPEIKSSSEVYGAVESSSLLREVPV
AGILGDQQAATFGQAAFDPGESKNTYGTGNFLIFNTGEEIVHSKNGLLTTLGYKLGDGKP
HYALEGSIAVTGSLVQWLRDNLGVISSAPEIEELAQTVEDNGGAYFVPALSGLFAPYWRA
DARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNADSGVDLTELKVDGGMIANNTL
MQFQADILGVPVVRPVVAETTALGAAYAAGLATGFWENLDDLRKNWKEDRRWEPKMDAAE
RDRQLRLWKKAVTKTFDWVDDDVRNG
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatacatcgtcgctatcgaccaaggcacaacaagcacccgggcgatcatcttc
gacaagtccgggtcgatcgtctcgaccgggcaattggagcacgagcagatcttcccgaag
ccgggctgggtcgagcacaaccccgtcgagatctggaacaacacccgcgaggtcatcggg
caggcgctctcgaaggccgatctgacccgccacgacatcgcggcggtgggcatcaccaac
cagcgcgagaccgcggtggtgtgggacaagaacaccggggagccggtctacaacgcgatc
gtctggcaggacacccgaacgcagccgatcgtggaccggctcgccgcggagggcggcgtc
gagcgcttcaagccgatcgtgggcctcccgctcgcgacctatttctcgggaaccaagatc
gtgtggatactcgagaacgtcgagggagtccgcgagcgcgccgaacgcggcgatctgctg
ttcggcaccaccgaaagctgggtcctctggaacctcaccggtggcaccgacggcggtgtg
catgccaccgatgtgaccaacgcctcccgcaccctgttcatggacctggagacgctgagc
tggcgggacgacatcctcgacgtgttcggggtgcccaagtcgatgctcccggagatcaag
agctcttccgaggtctacggcgcggtcgagtcgtcgagcttgctccgcgaggtgcccgtg
gcgggcatcctgggcgaccagcaggccgctacgttcggccaggcggcgttcgatccgggt
gagtccaagaacacctacggcaccggcaacttcctcatcttcaacacaggggaagagatc
gtccactccaagaacggcctcctcaccacgctcggctacaagctgggcgacggcaaaccg
cactacgccctggagggctcgatcgctgtcaccggttcgctggtgcagtggctgcgcgac
aacctcggcgtcatctcgagcgctcccgagatcgaggagctggcccaaacggtcgaggac
aacggcggcgcttacttcgtgccggcgttgtccgggctgttcgcaccgtactggcgcgcg
gacgcacgcggtgcgctcgtgggtctgacccgctatgtgaacaagggccacatcgcccgc
gccgccctggaagcgaccgcgtttcagacccgtgaggtgctggacgcggtgaacgcggac
tcgggcgtcgacctcacggagctgaaggtggacggcggcatgatcgccaacaacaccctg
atgcagttccaggccgacatcctgggcgttcccgtcgtccgtccggtcgtcgccgagacc
accgctctcggcgccgcctacgccgccggcctcgctaccggcttctgggagaacctggac
gatctgcgcaagaactggaaggaggaccgccgctgggagcccaagatggatgccgccgag
cgcgaccgccagctccgcctctggaagaaggccgtgacgaagaccttcgactgggtggac
gacgacgtgcgcaacggctga

DBGET integrated database retrieval system