KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx04530Help
Entry
Lxx04530          CDS       T00190                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00020  Citrate cycle (TCA cycle)
lxx00190  Oxidative phosphorylation
lxx00650  Butanoate metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
lxx01130  Biosynthesis of antibiotics
lxx01200  Carbon metabolism
Module
lxx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lxx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lxx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lxx04530 (sdhD)
   00650 Butanoate metabolism
    Lxx04530 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Lxx04530 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Smim3 RhodobacterPufX DUF4179
Motif
Other DBs
NCBI-ProteinID: AAT88444
UniProt: Q6AGQ1
Position
complement(453061..453504)
Genome map
AA seq 147 aa AA seqDB search
MTTIETPRTPARPARKGDNWEKWGWVYMRASGVVLVVLIFGHLLINLVLGDGVKQIDFAF
VAGKYATPFWQVWDLLMLWLALIHGGNGMRTLVNDYTANATLNRILKGAIAAAVVVLIVL
GTLVIFTFDPCPAGAAAGQLPSFCPAK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccatcgagacgccgcgcacgccggcccgccccgcccgcaaaggcgacaactgg
gagaagtggggctgggtctacatgcgcgcctccggcgtggtcctggtcgtcctcatcttc
ggccacctgctgatcaacctcgtcctcggcgacggcgtgaagcagatcgacttcgccttc
gtcgccggcaagtacgccaccccgttctggcaggtctgggacctgctgatgctgtggctg
gccctcatccacggcggcaacgggatgcggaccctggtcaacgactacaccgccaatgcg
acgctcaaccgcatcctcaagggggccatcgcggccgcggtcgtcgtgctgatcgttctg
ggaacgctcgtgatcttcacgttcgacccgtgccccgccggcgccgcagccggccagctg
ccctcgttctgcccggccaagtga

DBGET integrated database retrieval system