KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx04920Help
Entry
Lxx04920          CDS       T00190                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:lxx00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lxx00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
490878..491483
Genome map
AA seq 201 aa AA seqDB search
MQIRELTIPDAYEITPVQHADDRGLFFEFYRFDRLEEAVGHSLDLKQGNTSVSRRGSVRG
IHFADIPPSQAKYVMAPRGAVLDFVIDIRLGSPTFGQWDSVLLDDKDRRALYVAEGLGHC
FVALTADATVSYLVTDVYTPTREHGINPLDSDIALAFPVPEDELLLSPKDTDAPGLAEAQ
ASGLLPTWDAARDFYASLDHK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatccgagaactgacgatccccgacgcgtatgagatcacccccgtccagcacgcc
gacgaccgcggactcttcttcgagttctaccggttcgaccgtctcgaggaggccgtcggt
cactctctcgacctcaaacagggcaacacatcggtgtcgcggcgggggtcggtgcgcggc
atccacttcgccgacatcccgccgagccaggccaagtacgtgatggccccgcgcggagcg
gtgctcgacttcgtcatcgacatccgtttgggctcgccgacgttcggccaatgggactcg
gtgctcctcgacgacaaggaccgccgcgcgctctacgtcgcggaagggctcggccactgc
ttcgtcgccctgactgccgacgccaccgtcagctacctggtcaccgacgtctacaccccc
acgcgcgagcacgggatcaacccgctcgacagcgatatcgccctcgcgttcccggtcccg
gaggacgagctgctgctctcgccgaaggacacggacgcccccggactcgctgaggcgcag
gcgtccggcctgctgcccacctgggacgccgcacgcgatttctacgcctcgctcgaccac
aagtaa

DBGET integrated database retrieval system