KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx05910Help
Entry
Lxx05910          CDS       T00190                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Lxx05910 (galU)
   00052 Galactose metabolism
    Lxx05910 (galU)
   00500 Starch and sucrose metabolism
    Lxx05910 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Lxx05910 (galU)
Enzymes [BR:lxx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Lxx05910 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
600703..601674
Genome map
AA seq 323 aa AA seqDB search
MATSVTKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVEEAVEAGLHDVLMITGR
NKNALENHFDRNAELEDTLTKKGDTDRLRKVNYSTSLADMHYVRQGDPKGLGHAVLRAKM
HVGREPFAVLLGDDIIDARDDLLRRMLRVQHEHNTTVVALMEVDPDSIHLYGAAAVEPTG
EDDVVRITGLVEKPDKEDAPSNYAIIGRYILRPEVFDVLERTEPGRGGEIQLTDALQAMA
HAPDWTGGVYGVVFRGRRYDTGDRLDYIKAIVQLAADRDDLGPELRPWLREFAGGLADTP
DEALDEMPAEPAPSLGSTTDANA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccacctctgtcaccaaagccgtcatccctgcagccggtctcggcacgcgcttcctg
cccgccaccaaagcgatgcccaaggagatgctccccgtcgtcgacaaaccggccattcaa
tacgtggtcgaggaggcagtggaggccggactccacgacgtgctcatgatcaccggtcgc
aacaagaacgcgctggagaaccacttcgaccgcaacgccgagctggaggacaccctcacc
aagaagggcgacaccgaccggctgcggaaagtcaactactccacctcgctggcggacatg
cactacgtccgccagggcgacccgaaaggcctcggccacgccgtgctgcgcgcgaagatg
cacgtcggccgggagccgttcgccgtcctcctcggcgacgacatcatcgacgcccgcgac
gacctcctgaggcggatgttgcgggtgcagcacgagcacaacaccacggtggtcgctctc
atggaggtcgaccccgacagcatccacctctacggcgccgccgctgtcgagccgacgggc
gaggacgatgtggtgcgcatcaccggcctcgtcgagaaacccgacaaggaggacgcgcct
tcgaactacgccatcatcggccgctacatcctgcgccccgaggtcttcgacgtgctggag
cgcaccgagcccggccgcggcggcgagatccagctgaccgacgcgttgcaggcgatggcg
cacgcacccgactggaccggcggcgtctacggcgtcgtcttccgtggccgccgctacgac
acgggggaccggctcgactacatcaaagccatcgtccagctcgccgccgaccgcgacgat
ctcggccccgagctgcgcccgtggctgcgcgagttcgccggcggtctcgcggacaccccc
gacgaggccctggacgagatgccggccgagccggctccgtcgctaggatcgaccaccgac
gcgaacgcatag

DBGET integrated database retrieval system