KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx06520Help
Entry
Lxx06520          CDS       T00190                                 

Gene name
arg1
Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lxx06520 (arg1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    Lxx06520 (arg1)
   00330 Arginine and proline metabolism
    Lxx06520 (arg1)
Enzymes [BR:lxx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Lxx06520 (arg1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651556..652500)
Genome map
AA seq 314 aa AA seqDB search
MSGASFLVIPQWQGSGSSRAMRLIDGAEAVLGDLPVSRTHVVTVPAAAGEALGTGVQRYS
SLTAIRELAAAEIEVLAAPIVTVGGDCGADLASVQHAVSTRPGGALALVWFDAHGDLNDV
ATSPSGAFHGMVLRALLGDGPDGLASTGSAVLKPSSIVLAGTRALDEGESAFVAKNGIRV
VEPGDFDDPDALVRAVGASGATAVYLHIDLDVLDPAVVDGIGSPEPFGVTTEQLCDAIRA
LRARFELAGAAVTEFAPESAEAAVRDLPVILRVLGALTSPVAGPRTSGTPVAPVSPDAPS
STASGPQRLSTDAP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgcgtcgttcctcgtcatcccgcaatggcagggttccggttcgtcgcgggcc
atgcgcctgatcgacggcgcggaagccgtcctcggcgacctcccggtctcgcgaacccac
gtcgtgaccgttccggctgcggccggcgaggcgctcgggaccggggttcagcggtactcg
tcgctcaccgcgatccgcgagctggccgccgcggagatcgaggtgctcgcagcaccgatc
gtgaccgtgggtggagactgcggcgcggacctggcgagcgtacagcacgcggtttccact
cgtcccgggggcgcgctcgcgctcgtctggttcgacgcacacggcgatctgaacgacgtc
gccacttcgccgtcgggggcgtttcacggaatggtgctgcgcgctctgctcggcgacgga
ccggacggactcgcctcgacgggctccgctgtcctgaagccgtcctccatcgtgctcgcc
gggacgcgcgcactggacgagggcgagtcggccttcgtggcgaagaacggcatccgggtc
gtcgaaccgggcgacttcgatgacccagacgccctcgtccgcgccgtcggggcctccgga
gcgaccgcggtgtatctgcacatcgacctggatgtcctcgacccggcggtggtggacggg
atcgggtctccagagccgttcggggtgacgacggagcagctgtgcgatgccatccgggcg
ctgcgggcgcggttcgagctggccggggcggcggtgacggagttcgccccggagtcggcg
gaggcggcggtccgggatttgccggtgatcctgcgagttctgggcgcgctgacgagcccg
gtcgcgggtccgcgcacctctggcactccggtcgcacccgtttccccggacgctccttcc
tccacagcgtccggtccgcagcggttatccacagatgcgccgtga

DBGET integrated database retrieval system