KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx06880Help
Entry
Lxx06880          CDS       T00190                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lxx06880 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lxx06880 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Lxx06880 (thrC)
Enzymes [BR:lxx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Lxx06880 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
688675..689787
Genome map
AA seq 370 aa AA seqDB search
MLPSPKPHSRQWRGVLHEYADRLSVSASTPIVTFGEGGTPLIPAPALSARTGATVYVKFE
GMNPTGSFKDRGMTMAISKAVEHGAKAVICASTGNTSASAAAYAARAGVQAVVLVPEGKI
AKGKLSQAIAHNGRLLQVQGTFDDCLDIARDLAASYPVHLVNSVNPDRIEGQKTAAFEIV
EALGDAPDFHVVPIGNAGNYTAHHRGYTEELQRGEATKLPRMFGFQAAGSAPIVLGHPVK
DPDTIATAIRIGNPASWELALNARDDSGGYFGAIADAKILEAHRILSAEAGVFVEPASAI
SVAGLLERSEAGVIPAGATVVLTVTGHGLKDPQWALRTADGSEVQPTFVPVDTAAVAETL
GLTSNTGVSA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgctcccgtcgccgaaaccgcacagcaggcagtggcgcggtgtcctccacgagtacgcc
gaccgcctgagcgtctccgcgtcgacgccgatcgtgaccttcggcgaaggcggcaccccg
ctcatcccggctccggccctctcggcccgcaccggtgcgaccgtgtacgtcaagttcgag
gggatgaaccccaccggctccttcaaggaccgcggcatgacgatggcgatctccaaggcg
gtggagcacggcgcgaaggccgtcatttgcgcttcgaccggcaacacctccgcctcggcc
gcggcgtatgcggcccgcgccggcgttcaggccgtcgtcctcgtgccggagggcaagatc
gcgaaaggcaagctcagccaggcgatcgcccacaacggccggctgcttcaggtccagggc
actttcgacgactgcctcgacatcgcccgcgaccttgcggctagctatccggttcatctg
gtcaactcggtcaaccccgaccgcatcgaaggacagaagacagcggcgttcgagatcgtc
gaagcgctcggcgatgcgccggacttccacgtcgtccccatcggcaacgccggcaactac
accgcccaccaccgcggttacaccgaggagctgcagcgcggcgaggccacgaagctgccc
cggatgtttggcttccaggccgcaggaagcgcgccgatcgtgctcggccatcccgtgaag
gacccggataccatcgccaccgccatccggatcggaaacccggcgtcgtgggagctcgcg
ctgaacgcgcgcgacgacagcgggggctacttcggcgcgatcgccgatgccaagattctg
gaggcgcatcgcatcctgtcggcggaggccggcgtcttcgtggagccggccagtgcgatc
agcgtcgccggtctgctggagcgctcggaggcgggcgtcatcccagccggcgcgaccgtg
gtgctcacggtgaccggtcacggcctgaaagacccgcagtgggcgctgcgcaccgcggac
ggctccgaggttcagcccaccttcgtcccggtcgacaccgctgccgtcgccgagacgctc
ggcctgacctcgaacacgggagtgagcgcgtga

DBGET integrated database retrieval system