KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx07000Help
Entry
Lxx07000          CDS       T00190                                 

Gene name
atpE
Definition
ATP synthase, C chain
Orthology
K02110  
F-type H+-transporting ATPase subunit c
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Lxx07000 (atpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701054..701275
Genome map
AA seq 73 aa AA seqDB search
MDIAAINGNIATVGYGLAAIGPAIGVGIVVGKTIESVARQPELAGRLQVLMYIGIAFTEA
LAFIGIATYFIFQ
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcgctgcaatcaacggcaacatcgccaccgtcggttacggcctcgccgccatc
ggcccggccatcggcgtgggcatcgtcgtcggcaagaccatcgagagcgtcgcccgtcag
cccgagctggctggccgtctccaggtcctgatgtacatcggtatcgcgttcaccgaggcg
ctcgccttcatcggtatcgcgacctacttcatcttccagtaa

DBGET integrated database retrieval system