KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx07530Help
Entry
Lxx07530          CDS       T00190                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lxx07530 (pfkA)
   01230 Biosynthesis of amino acids
    Lxx07530 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lxx07530 (pfkA)
   00030 Pentose phosphate pathway
    Lxx07530 (pfkA)
   00051 Fructose and mannose metabolism
    Lxx07530 (pfkA)
   00052 Galactose metabolism
    Lxx07530 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Lxx07530 (pfkA)
Enzymes [BR:lxx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Lxx07530 (pfkA)
Protein phosphatases and associated proteins [BR:lxx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Lxx07530 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
753935..755011
Genome map
AA seq 358 aa AA seqDB search
MLRGGDKAGGDEKRSSMKIGILTSGGDCPGLNAVIRGAVLKGDRVLDAEFAGFRYGWRGV
VEGDIMPLDRHSVRGLSRQGGTILGSSRTNPFEGEKGGPENIQRMMDENGIDAIIAIGGE
GTLTAARRLTDAGLRIVGVPKTIDNDLAATDYSFGFDTAVEIATEAIDRLRTTAESHQRC
MVLEVMGRHVGWIALHSGMAGGAHAILIPELPQSVDRICEWVESVRDRGRAPVIVVSEGF
HLDTMEEAHSHKGLDAFNRPRLGGIGEMLAPLIQERTGIESRATVLGHMQRGGVPSAYDR
VLATRLGMAAVDAAYEGRWGSMVALRGTDVVNVSIADATGGLKTVPQARYDEAALLFG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggggcggcgacaaggccgggggagacgagaaacggagcagcatgaagatcggc
atcctgaccagcggcggcgactgcccggggctgaacgcggtcatccgcggcgctgtcctc
aagggcgaccgggtcctcgacgcggagttcgccggtttccgctacggctggcgcggcgtg
gtcgagggcgacatcatgcccctcgaccgccactcggtgcgcggcctctcccggcagggt
ggcacgatcctcgggtcgagccgcaccaacccgttcgagggggagaagggcggtcccgag
aacatccagcggatgatggatgagaacggcatcgacgcgatcatcgcgatcggcggcgag
ggcacactcacggcggctcgccggctcaccgacgctggtctgcgcatcgtcggcgtcccg
aagaccatcgacaacgatctcgccgccaccgactactcgttcggcttcgacacggcggtg
gagatcgcgaccgaggcgatcgaccggctgcgcacgacggcggagtcgcaccagcgctgc
atggtcctggaggtcatgggccgccacgtcggctggatcgccctccattcgggcatggcc
ggtggcgcacacgccatcctcatccccgagctgccgcagtccgtcgaccggatctgtgag
tgggtcgagtcggtccgggaccgcggccgtgcgcccgtcatcgtggtctccgagggcttc
cacctcgacacgatggaggaggcgcactcgcacaagggcctggacgccttcaaccggccg
cggctcggcggcatcggcgagatgctcgcccccctcatccaggagcgcaccgggatcgag
tcgcgcgcgaccgttctcggccacatgcagcgcggcggtgtcccgagcgcgtacgatcgc
gtgctcgccacccgcctcggcatggcggcggtggatgcggcctacgagggccgctggggc
tcgatggtggcgttgcgcggcaccgatgtcgtgaacgtctcgatcgcggacgcgaccggc
gggctgaaaacggtcccgcaggcgcgttatgacgaagcggccctccttttcggctga

DBGET integrated database retrieval system