KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx07530Help
Entry
Lxx07530          CDS       T00190                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00010  Glycolysis / Gluconeogenesis
lxx00030  Pentose phosphate pathway
lxx00051  Fructose and mannose metabolism
lxx00052  Galactose metabolism
lxx00680  Methane metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
lxx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lxx07530 (pfkA)
   00030 Pentose phosphate pathway
    Lxx07530 (pfkA)
   00051 Fructose and mannose metabolism
    Lxx07530 (pfkA)
   00052 Galactose metabolism
    Lxx07530 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Lxx07530 (pfkA)
Enzymes [BR:lxx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Lxx07530 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Lxx07530 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAT88673
UniProt: Q6AG22
Position
753935..755011
Genome map
AA seq 358 aa AA seqDB search
MLRGGDKAGGDEKRSSMKIGILTSGGDCPGLNAVIRGAVLKGDRVLDAEFAGFRYGWRGV
VEGDIMPLDRHSVRGLSRQGGTILGSSRTNPFEGEKGGPENIQRMMDENGIDAIIAIGGE
GTLTAARRLTDAGLRIVGVPKTIDNDLAATDYSFGFDTAVEIATEAIDRLRTTAESHQRC
MVLEVMGRHVGWIALHSGMAGGAHAILIPELPQSVDRICEWVESVRDRGRAPVIVVSEGF
HLDTMEEAHSHKGLDAFNRPRLGGIGEMLAPLIQERTGIESRATVLGHMQRGGVPSAYDR
VLATRLGMAAVDAAYEGRWGSMVALRGTDVVNVSIADATGGLKTVPQARYDEAALLFG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggggcggcgacaaggccgggggagacgagaaacggagcagcatgaagatcggc
atcctgaccagcggcggcgactgcccggggctgaacgcggtcatccgcggcgctgtcctc
aagggcgaccgggtcctcgacgcggagttcgccggtttccgctacggctggcgcggcgtg
gtcgagggcgacatcatgcccctcgaccgccactcggtgcgcggcctctcccggcagggt
ggcacgatcctcgggtcgagccgcaccaacccgttcgagggggagaagggcggtcccgag
aacatccagcggatgatggatgagaacggcatcgacgcgatcatcgcgatcggcggcgag
ggcacactcacggcggctcgccggctcaccgacgctggtctgcgcatcgtcggcgtcccg
aagaccatcgacaacgatctcgccgccaccgactactcgttcggcttcgacacggcggtg
gagatcgcgaccgaggcgatcgaccggctgcgcacgacggcggagtcgcaccagcgctgc
atggtcctggaggtcatgggccgccacgtcggctggatcgccctccattcgggcatggcc
ggtggcgcacacgccatcctcatccccgagctgccgcagtccgtcgaccggatctgtgag
tgggtcgagtcggtccgggaccgcggccgtgcgcccgtcatcgtggtctccgagggcttc
cacctcgacacgatggaggaggcgcactcgcacaagggcctggacgccttcaaccggccg
cggctcggcggcatcggcgagatgctcgcccccctcatccaggagcgcaccgggatcgag
tcgcgcgcgaccgttctcggccacatgcagcgcggcggtgtcccgagcgcgtacgatcgc
gtgctcgccacccgcctcggcatggcggcggtggatgcggcctacgagggccgctggggc
tcgatggtggcgttgcgcggcaccgatgtcgtgaacgtctcgatcgcggacgcgaccggc
gggctgaaaacggtcccgcaggcgcgttatgacgaagcggccctccttttcggctga

DBGET integrated database retrieval system