KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx08070Help
Entry
Lxx08070          CDS       T00190                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lxx08070 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Lxx08070 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Lxx08070 (proB)
Enzymes [BR:lxx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Lxx08070 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816591..817403
Genome map
AA seq 270 aa AA seqDB search
MTIDDRGQIRSARRIVVKVGSSSISGENAGQIGPLVDALAEAHGRGSQVVLVSSGAIATG
IPYLALTERPKDLATQQAAAAVGQNVLIYRYQDSLDRYGIVAGQVLLTARDVENPTHRSN
AKRAMERLLDLRILPIVNENDTVATHEIRFGDNDRLAALVAKLVEADLLVLLSDVDALYT
KPPQESGAERIAHVGWNDQLEGVEIGSAGPSGVGTGGALTKVSAARQAAEHGTAVVLTAT
SLVVDALRGEPVGTWFAPAQETAVESAPAS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgacgaccgcggccagatccgctccgcccggcgcatcgttgtgaaggtgggc
tcctcctccatcagcggcgagaacgcaggccagatcggcccgttggtggacgccctggcc
gaagcccacggccgcggttcgcaggtcgtcctcgtctcctcgggcgcgatcgcgacgggc
atcccgtatctcgccctcacggagcgtccgaaggatctcgccactcagcaggctgccgcc
gcagtcgggcagaatgtgctcatctaccgttaccaggacagcctcgaccggtacggcatc
gtcgccggtcaggtgttgctgaccgcgcgcgacgtggagaatccgacgcatcggagcaat
gcgaaacgcgcgatggagcggctgctcgatctgcgcattctgccgatcgtcaacgagaac
gacaccgttgcgacgcatgagatccgcttcggcgacaacgaccgcctcgccgcgctcgtg
gcgaagctggtcgaggccgatctgctggtactcctctccgatgtggacgcgctctacacc
aaacccccgcaggaatccggcgccgagcggatcgcccacgtcggctggaacgaccagctg
gagggcgtcgagatcggctcggccggtccctccggcgtcggcaccggcggcgcactgacg
aaggtctcggcggctcgtcaggccgccgagcacggcacagcggtggtgctcaccgcgacc
tcgctcgtggtggatgcgcttcgcggggagccggtcggcacctggttcgcgccggcgcag
gagacggccgtggaaagcgctccggcgtcctag

DBGET integrated database retrieval system