KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx09800Help
Entry
Lxx09800          CDS       T00190                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lxx03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001513..1002406
Genome map
AA seq 297 aa AA seqDB search
MPELPEVEVVRAGLAPAVTGATILGVEVFELRSLKRHDPLAGSFESLLTGRSMQTPARRG
KFLWIPLDSSPRSAIVAHLGMSGQILLRDPGTVENGLLRIRLYIEHPEHGELWVHFVDQR
LFGSMAVDALVPTVDGAPAGLGTDEALLPAQVSHIARDPLDPVFDDAAFAAVLARRRSGI
KRVLLDQTLISGIGNIYADESLWAARIHYDHPATALSRPRVRTLLAELRRVLGRALAEGG
TSFDAQYVNVNGASGYFSRSLHVYGRQGQPCDRCGTAIVRESFMNRGSHFCPRCQRM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaactccccgaggttgaggtcgtccgcgcgggcctcgcccccgcggtcaccggc
gcgaccatcctcggcgtcgaggtgttcgagctacgctccctgaaacgccacgacccgctg
gccggctcgttcgagtcgctcctcaccggccgcagtatgcagacaccggcccgtcgtggg
aaattcctctggattcccctcgacagctcaccgaggagtgcgatcgtggcccacctcggg
atgagcggccagattctgcttcgcgaccccggcactgtcgagaatggcctgctgcgcatc
cggctgtacatcgagcatcctgagcacggtgagctctgggtacacttcgtagaccagcgc
ctcttcggctcgatggccgtcgacgccctcgtcccgacggtggacggcgctcccgccggg
ctcgggacggacgaagcgctcctcccggctcaggtcagtcacatcgcccgtgacccgctc
gaccccgtcttcgacgatgccgcgttcgccgccgttcttgcgcgccgccgcagtggcatc
aaacgtgtcctccttgaccagacactcatcagcggcatcggcaatatctatgccgatgaa
tcgctctgggcggcgcgcatccattacgaccaccctgcgaccgccctcagccgtccgagg
gtgcgcacgctgctcgccgagctgcgccgcgtgctcggaagggctctcgcggagggcggc
acgagcttcgacgcccagtacgtcaacgtgaacggcgcctccgggtatttttcccgatcc
cttcacgtttatgggcggcaaggccagccctgtgaccgctgcggcaccgcgatcgtgcgc
gagagcttcatgaaccggggttcgcacttctgcccgaggtgccagcggatgtga

DBGET integrated database retrieval system