KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx09920Help
Entry
Lxx09920          CDS       T00190                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00670  One carbon pool by folate
lxx00790  Folate biosynthesis
lxx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lxx09920 (folA)
   00670 One carbon pool by folate
    Lxx09920 (folA)
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Lxx09920 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AAT88864
UniProt: Q6AFI1
Position
complement(1014965..1015444)
Genome map
AA seq 159 aa AA seqDB search
MSIALIWAQARNRVIGAGGTMPWRLPEDLRHFRELTGGEPVVMGRRTWESLPDRFRPLPG
RRNIVVTRQEGWNAPGAEVAHALPGALSAASDDTVWVIGGGELYRQALPLADRVEVTEID
LAVAGDTPAPALGPEWHAQPTPWLTAENGMRYRFLRYLR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgccctcatctgggcgcaggcccgcaaccgcgtcatcggcgccggcgggacg
atgccctggcgcctccccgaggatctgaggcacttccgcgagctgaccggcggcgagcca
gtcgtgatgggacgccgcacctgggagtcgctccccgaccgcttccggccgctccccggc
cggcgcaacatcgttgtcacccgccaggaggggtggaacgcgccgggcgcggaggtcgcg
cacgccctgcccggagctctctccgccgccagcgacgacacggtgtgggtcataggcggc
ggggagctctatcgtcaggcgctccctctcgccgaccgcgtcgaggtcaccgagatcgac
ctcgctgtcgcgggcgacacgcccgcgcccgcgctgggacccgaatggcacgcgcagccc
accccctggctgacggcggagaacgggatgcgctaccgcttcctccgctacctcaggtga

DBGET integrated database retrieval system