KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx09960Help
Entry
Lxx09960          CDS       T00190                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00010  Glycolysis / Gluconeogenesis
lxx00520  Amino sugar and nucleotide sugar metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
lxx01130  Biosynthesis of antibiotics
lxx01200  Carbon metabolism
Module
lxx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lxx09960 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Lxx09960 (glk)
Enzymes [BR:lxx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Lxx09960 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG DUF4445
Motif
Other DBs
NCBI-ProteinID: AAT88868
UniProt: Q6AFH7
Position
complement(1018467..1019219)
Genome map
AA seq 250 aa AA seqDB search
MSSNHAIGIDIGGTGIKGGLVDLVSGELVSDRVKLPTPQGGGPEDIVETTREIVQQLAAE
EPHAPVGVCFPAIVSRGVTLSASNISKKWIGLAAEKLFETALGRDIHFVNDADAAGYAET
RFGAAKGRDGLVIMTTLGTGIGSALIYDGVLIPNAEIGHLEIDGKNAESRAAFSAKERED
LSWEKWAKRLQKYYSTVEFLFTPDLFIVGGGVSKNHTEFLPLLDLKTEIVPAVHRNNAGI
LGAAALAANP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaaccacgcaatcggaatcgacatcggcggcaccggcatcaagggggggctg
gtcgacctcgtcagcggcgaactcgtgagcgaccgcgtcaagctgcccaccccccagggc
ggcggtcccgaggacatcgtcgagacgaccagagagatcgtgcagcagctcgcggccgaa
gagccccacgcccccgtcggtgtctgcttccccgcgatcgtcagccgcggcgtgacgctc
tcggcgtccaacatcagcaagaagtggatcggcctggcggccgagaagctgttcgagacg
gccctcggccgcgacatccacttcgtcaacgacgccgacgccgccggctacgccgaaacc
cgcttcggggccgccaagggccgcgacggcctcgtcatcatgaccaccctcggcaccggc
atcggctcggcgctcatctatgacggcgtcctcatcccgaacgccgagatcgggcacctg
gagatcgacggcaagaacgccgaatcgcgcgccgccttctccgcgaaggagcgtgaggac
ctgtcgtgggagaagtgggccaagcgcctgcagaagtactactcgaccgtggagttcctg
ttcacgccggatctgttcatcgtcggcggcggcgtctcgaagaaccacacggagttcctt
ccgctgctggatctgaagacggagatcgtgcccgcggtccaccggaacaacgcgggcatc
ctcggcgcggcggcactggctgcgaacccctag

DBGET integrated database retrieval system