KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx11280Help
Entry
Lxx11280          CDS       T00190                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lxx11280 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lxx11280 (trpC)
Enzymes [BR:lxx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Lxx11280 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153481..1154263
Genome map
AA seq 260 aa AA seqDB search
MPVDLLADLTAGALEDAARRRADRPLSAVEAVAAAQAPPLPALDALAPADRVKVIAEVKR
ASPSRGDLAEIPDPAALARLYETGGASAISVLTEERRFRGSLADLESVRAAVSLPVLRKE
FIADPYQVFEARAAGADLVLLIVAALEQRRLAELHDLIVELGMTPLVEAHTADELSRAFD
TGAKLVGVNARDLSTFELDRNLFGRLAERYPSDVIRVAESAVKSAADVAHYRAAGAHVVL
VGEALVTSDPVATLSEFRGV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtcgacttgctcgccgacctcaccgccggcgcgttggaggatgcggcccggcgt
cgggcggatcgccccctgagcgctgtggaggccgtggccgctgcgcaggccccgcccctc
cccgcccttgacgcgctcgccccggcggaccgggtgaaggtcatcgccgaggtgaagcgc
gcgagcccgtctcgcggcgatctcgcagagatccccgatcccgccgcgctggcccgcctc
tacgagaccggcggcgccagcgcgatcagcgtcctcaccgaggagcgccgcttccgcgga
tcactggcggatctggagtccgtgcgcgcggccgtgtcgctcccggtcctccgcaaggag
ttcatcgcggacccgtaccaggtgttcgaggcgcgcgccgcgggcgcagacctcgtgctc
ctcatcgtcgccgcgctggagcagcggcggctggccgagctacacgatctcatcgtcgag
ctgggcatgactccgctcgtggaggcccacacggccgatgagctgagccgtgcgttcgac
accggcgcgaaactcgtgggtgtgaacgcgcgcgatctctccacgttcgagctggaccgc
aatctgttcggccgtctggccgagcggtacccgtccgatgtcatccgcgtggcggagtcg
gctgtgaagtcggccgccgatgtcgcgcactaccgggcggcgggtgcgcatgtcgtgctc
gtcggcgaggcgcttgtcacgagcgaccccgtcgcgacgctcagcgagttccgaggagtc
tga

DBGET integrated database retrieval system