KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx11300Help
Entry
Lxx11300          CDS       T00190                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lxx11300 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lxx11300 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lxx11300 (trpA)
Enzymes [BR:lxx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lxx11300 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155471..1156256
Genome map
AA seq 261 aa AA seqDB search
MSRVADTIARRKGEAAGALIGYLPAGFPDLRTSVDAAVALAENGVDVIELGLPYSDPVMD
GAVIQAATQRALANGFRLRDGFAAVREITSRVDAPVLVMTYWNPVMQYGVDRFADDFATA
GGAGLITPDLIPDEGADWLAASERTGLDRVFLAAPSSTEARRRQTAANSRGFVYAVSTMG
ITGVRTDVDAAARTLVGRLREAGALSACVGLGISSAAQVAEVLDYADGAIVGSALVTALA
KGGVAAAGRIAAELARGAVRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtgtggcagacaccatcgcccgccgcaagggggaggccgcgggcgcgctgatc
ggctacctcccggcgggtttccccgacctgcggacgagcgtcgacgctgcggttgcgctg
gcggagaacggcgtcgatgtcatcgaacttggcctcccgtactcggaccctgtgatggac
ggtgcggtcatccaggccgccacgcagcgcgcgctcgcgaacggtttccgcctgcgcgat
ggcttcgcggctgtgcgcgagatcaccagccgtgtcgatgcgcctgtcctggtcatgacc
tactggaacccggtgatgcagtacggcgtcgaccgcttcgccgacgattttgccacagcc
gggggagccgggctcatcacccccgatctcatccccgacgagggcgccgactggctcgcg
gcttccgagcgcaccggcctcgaccgggtcttcctcgcggccccgtcctccaccgaggct
cgccggcggcagaccgccgcgaacagccgcggtttcgtctacgccgtctctacgatgggc
atcacgggcgtccggaccgatgtggacgctgcggcccgcacgctcgtcggtcgccttcgc
gaggctggtgcgctgagcgcttgcgtcggactcggcatctcctccgccgcgcaggtggcg
gaagtgctcgactacgccgacggggcgatcgtcggttcggcgctcgtcacggcgctggcg
aaggggggcgtcgcggcggccggccggatcgccgccgagctggctcgcggagccgttcgc
ggctga

DBGET integrated database retrieval system